SecReT4
Protein ID: 325980835
T4SS name [ID]Trb [233]
Gene symbol-
Locus tagNAL212_0115
StrainNitrosomonas sp. AL212 plasmid pNAL21202 (NC_015221)
Repliconplasmid pNAL21202 [GenBank: NC_015221] [Browse all T4SS(s) in this replicon]
Location [Strand]15250..15663 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDF0TD69
KEGG IDnit:NAL212_0115
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-14, Aligned region: 11..106
Protein Sequence: 137 a.a.     [Download]
>gi|325980835|ref|YP_004293238.1| conjugal transfer protein Trbc [Nitrosomonas sp. AL212]
MKLISIKGVSSISCFFSIAIFFVLLFTVDQAQATVGAGGALPYETWLVSLRNSVTGPVAFTLSIVGIVVA
GGILIFGGELNAFFRTLIFIVLVMALLVGANNVMTNLFQGAVIPQGTVIPGEASGTIVELEEAIPQS
 
Nucleotide Sequence: 414 bp     [Download]
>gi|325980815|ref|NC_015221.1|:c15663-15250 Nitrosomonas sp. AL212 plasmid pNAL21202, complete sequence
ATGAAGTTAATCAGTATCAAGGGTGTCTCTTCAATCAGTTGTTTCTTCTCTATCGCTATTTTTTTCGTTC
TTCTATTCACAGTTGATCAAGCGCAAGCAACTGTTGGCGCAGGTGGAGCACTTCCCTATGAAACCTGGCT
GGTGAGTCTCAGGAACTCCGTTACCGGCCCGGTTGCGTTTACCTTGTCTATTGTTGGCATTGTGGTTGCA
GGCGGCATTCTGATCTTTGGTGGCGAACTCAATGCTTTTTTCCGCACCTTGATTTTTATCGTGTTGGTGA
TGGCGTTACTCGTTGGAGCCAACAATGTCATGACTAATTTATTCCAGGGTGCTGTTATTCCCCAAGGCAC
GGTCATTCCGGGTGAAGCGTCAGGGACAATTGTAGAGTTAGAAGAAGCTATCCCTCAAAGTTAG
 Primer design