SecReT4
Protein ID: 325983737
T4SS name [ID]Trb [50]
Gene symbol-
Locus tagNAL212_0026
StrainNitrosomonas sp. AL212 plasmid pNAL21201 (NC_015223)
Repliconplasmid pNAL21201 [GenBank: NC_015223] [Browse all T4SS(s) in this replicon]
Location [Strand]29955..31043 [-]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF0TD14
KEGG IDnit:NAL212_0026
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4e-31, Aligned region: 68..285
Protein Sequence: 362 a.a.     [Download]
>gi|325983737|ref|YP_004296138.1| P-type conjugative transfer protein TrbL [Nitrosomonas sp. AL212]
MFRTPVTFYFLFFLLFFSAGAFAELAYIDPATNQSVLDQVVNKFQGKVKSWQNIIQAAAERLFWTLVLIS
MVWTFGMMLLRKADIGDFFAEFTRFIIFTGFYFWLLTNAVSGHNIAGTIIDSMQQLGGTAAGLPSGASHS
SIMDIGVLIWNQATHSLTFMQPMDSLMGFVISLIILIILAVIAVNMLLLLISSWVLMYAGIFFLGFGGAR
WTSDIAINYFKTVLGIGIQLFVMLLIVGIGSDLLSSFYAKMGKNVMNYEELAVMLIFTIAFFVLISRLPS
LLAGIITGSSIGSSTGIGSYGAGGFMAAAGTAAAVASYGGSLAADRLAAARSTGPDALRSAIEKGQAQES
AGMNNISQGGGK
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|325983714|ref|NC_015223.1|:c31043-29955 Nitrosomonas sp. AL212 plasmid pNAL21201, complete sequence
ATGTTCAGAACACCAGTTACCTTTTACTTCCTATTTTTTCTATTGTTCTTTTCTGCTGGTGCATTTGCCG
AACTTGCCTATATTGATCCAGCAACCAATCAAAGTGTTTTGGATCAAGTTGTTAATAAGTTTCAAGGCAA
AGTTAAATCCTGGCAAAATATTATCCAGGCTGCAGCCGAGCGTTTGTTCTGGACGTTGGTGCTGATTTCA
ATGGTCTGGACATTTGGCATGATGCTATTGCGTAAAGCCGATATAGGAGATTTCTTTGCTGAATTTACTC
GTTTCATTATTTTTACAGGGTTTTATTTCTGGCTGCTGACCAATGCCGTATCGGGCCACAATATTGCGGG
CACTATCATAGATTCGATGCAGCAATTAGGTGGAACTGCCGCCGGTTTGCCGAGTGGTGCCAGTCATTCC
AGTATTATGGATATAGGTGTTTTAATCTGGAACCAGGCAACACATAGTCTTACATTCATGCAGCCTATGG
ATAGTTTGATGGGTTTTGTTATTTCGTTGATTATTTTAATTATCCTGGCTGTAATTGCAGTCAATATGTT
GCTCTTGCTGATCTCATCCTGGGTACTCATGTATGCAGGTATCTTCTTTTTAGGTTTTGGTGGAGCGCGC
TGGACATCCGACATCGCCATTAACTACTTTAAAACAGTCCTGGGTATCGGTATTCAATTATTTGTGATGC
TTCTGATCGTTGGCATTGGCAGTGATCTGTTATCCAGTTTTTACGCCAAAATGGGTAAAAATGTTATGAA
TTATGAAGAACTGGCGGTTATGCTGATTTTTACGATTGCATTTTTTGTATTGATTTCCAGATTACCATCG
TTACTGGCTGGCATTATAACGGGTAGTAGCATAGGCTCGAGCACTGGAATTGGCAGCTATGGCGCCGGTG
GTTTTATGGCAGCGGCAGGTACCGCTGCAGCTGTTGCATCTTATGGTGGATCACTGGCAGCCGATCGGTT
AGCAGCGGCAAGAAGTACGGGACCGGATGCTTTACGTAGTGCTATTGAAAAGGGTCAGGCTCAGGAATCT
GCGGGTATGAACAATATTTCGCAAGGAGGGGGTAAATGA
 Primer design