SecReT4
Protein ID: 325983742
T4SS name [ID]Trb [50]
Gene symbol-
Locus tagNAL212_0031
StrainNitrosomonas sp. AL212 plasmid pNAL21201 (NC_015223)
Repliconplasmid pNAL21201 [GenBank: NC_015223] [Browse all T4SS(s) in this replicon]
Location [Strand]34034..34942 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF0TD19
KEGG IDnit:NAL212_0031
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.8e-58, Aligned region: 74..300
Protein Sequence: 302 a.a.     [Download]
>gi|325983742|ref|YP_004296143.1| P-type conjugative transfer protein TrbG [Nitrosomonas sp. AL212]
MKPLLSLRKLSTLIFSLGLVAPSYAAGLSDAYFTDKNPQLTPQERAAIDLAKKWQAVNPSGTKPVAGPDG
SIRFLFGSQQPSIVCAVLQVCDIELQPGEQVNSIHLGDQARWLVEPAVTGQGALEVQHLIIKPLDVGLET
SLVVTTNRRTYHMRLRSHRRDFMPRVGFTYPEDALAKWDAIKSRESHAMDIRRSNTIAQTGEYLGNLDFA
YSVDGSAAWKPLRVYNDGHKTIIQMPSIMAQTEAPTLLLLTKEGGLFREDETVMVNYRLQGDRYIVDAVF
DKAMLIAGVGGNQSRVTITRGN
 
Nucleotide Sequence: 909 bp     [Download]
>gi|325983714|ref|NC_015223.1|:c34942-34034 Nitrosomonas sp. AL212 plasmid pNAL21201, complete sequence
ATGAAACCGTTACTCTCTTTAAGAAAGCTTAGCACGCTGATTTTCTCTCTTGGACTCGTTGCACCAAGCT
ATGCTGCTGGTTTGTCTGATGCGTATTTCACCGATAAGAACCCTCAACTGACACCACAGGAACGTGCCGC
TATTGATCTAGCCAAGAAATGGCAAGCAGTCAATCCTAGTGGCACAAAACCTGTTGCAGGACCGGATGGA
TCAATCCGTTTTCTGTTTGGTTCACAGCAACCCAGCATCGTCTGTGCAGTATTGCAGGTATGCGATATTG
AATTGCAGCCGGGAGAACAGGTGAATTCCATCCATCTGGGCGATCAGGCGCGTTGGCTGGTTGAACCGGC
AGTGACAGGGCAGGGGGCTCTAGAGGTACAACATTTAATTATAAAACCCTTGGATGTGGGTCTGGAGACA
TCGCTTGTTGTTACGACTAACCGGCGCACGTATCACATGCGATTGCGATCCCATCGGCGTGATTTCATGC
CGAGAGTGGGTTTTACGTACCCTGAGGATGCGTTGGCCAAATGGGATGCGATTAAAAGCCGTGAAAGCCA
TGCGATGGACATTAGAAGGTCAAATACGATAGCGCAAACCGGAGAATATCTGGGTAATCTGGATTTTGCG
TATTCAGTAGACGGTAGTGCTGCCTGGAAACCCTTGCGTGTCTATAACGATGGTCACAAAACCATCATCC
AAATGCCATCCATTATGGCGCAGACGGAGGCACCGACTTTACTGTTGTTAACTAAGGAAGGCGGGCTGTT
TAGAGAGGATGAGACGGTCATGGTGAATTACCGCTTGCAAGGTGATCGCTATATCGTAGATGCCGTGTTT
GACAAGGCAATGTTGATTGCGGGTGTAGGTGGCAATCAAAGCCGGGTGACGATTACGCGGGGGAATTGA
 Primer design