SecReT4
Protein ID: 325983746
T4SS name [ID]Trb [50]
Gene symbol-
Locus tagNAL212_0035
StrainNitrosomonas sp. AL212 plasmid pNAL21201 (NC_015223)
Repliconplasmid pNAL21201 [GenBank: NC_015223] [Browse all T4SS(s) in this replicon]
Location [Strand]38595..38990 [-]
Productconjugal transfer protein Trbc
Component typeTrbC
UniProt IDF0TD23
KEGG IDnit:NAL212_0035
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.8e-14, Aligned region: 17..106
Protein Sequence: 131 a.a.     [Download]
>gi|325983746|ref|YP_004296147.1| conjugal transfer protein Trbc [Nitrosomonas sp. AL212]
MKLISIKGISPFGCIYSFVVLFLLLLSADQAQATVGAGGALPYETWLVSLRNSVTGPVAFTLSIVGIVVA
GGILIFGGELNAFFRTLIFIVLVMALLVGANNVMTNLFQGAVIPGGASGTIVALEEAIPQS
 
Nucleotide Sequence: 396 bp     [Download]
>gi|325983714|ref|NC_015223.1|:c38990-38595 Nitrosomonas sp. AL212 plasmid pNAL21201, complete sequence
ATGAAGTTAATCAGTATCAAGGGTATCTCTCCATTCGGTTGTATCTATTCATTCGTTGTCTTGTTTTTAC
TACTATTGTCTGCTGATCAAGCCCAAGCAACCGTTGGCGCAGGTGGAGCACTTCCCTATGAAACCTGGCT
TGTTAGTCTCAGAAACTCCGTTACCGGCCCGGTTGCTTTTACTCTATCGATCGTCGGCATTGTGGTTGCA
GGCGGCATTCTGATCTTTGGTGGCGAACTCAATGCTTTTTTCCGCACCCTGATTTTTATCGTGCTGGTGA
TGGCGTTACTTGTTGGAGCCAACAATGTGATGACCAATCTATTCCAGGGCGCGGTCATTCCGGGTGGAGC
GTCAGGGACAATCGTAGCGTTAGAAGAAGCTATCCCTCAAAGTTAG
 Primer design