SecReT4
Protein ID: 326326049
T4SS name [ID]Tra_F [513]
Gene symbol-
Locus tagVIBNI_0117
StrainVibrio nigripulchritudo plasmid VIBNI_pA (NC_015156)
Repliconplasmid VIBNI_pA [GenBank: NC_015156] [Browse all T4SS(s) in this replicon]
Location [Strand]127808..128566 [-]
ProductPutative conjugative transfer protein TraF
Component typeTraF_F
UniProt IDF0V145
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 8.4e-60, Aligned region: 25..241
Protein Sequence: 252 a.a.     [Download]
>gi|326326049|ref|YP_004250858.1| Putative conjugative transfer protein TraF [Vibrio nigripulchritudo]
MKASILIPLLVLYPTLCLATTPPQGWRWYNEPAEPKVLRRPSTGLPPNTVTTVMTATEQMDWFHATYQEA
LNAATLDPGNPEKYLTVMRMHHFIGEKVSQTGMTFKQLLLTHPELSYVRDRPVQQAARGPYLAQQRQKKT
EIVTQLVDRGWGLMFVYRGNDAISQRLAPSLQQFADAHQFELLGVSEDDTFIDAVRHNRRNRGKVTVPYT
PAILMVHPKTAEFKPLAYGFISQSELLSRVYNAATDYQIPDF
 
Nucleotide Sequence: 759 bp     [Download]
>gi|326325966|ref|NC_015156.1|:c128566-127808 Vibrio nigripulchritudo plasmid VIBNI_pA, complete genome
ATGAAGGCATCCATTCTCATCCCCTTATTAGTCTTATATCCCACCCTGTGTCTGGCGACAACGCCCCCTC
AAGGATGGCGGTGGTACAACGAACCTGCAGAGCCGAAAGTTCTTCGGCGTCCGTCAACCGGGTTGCCACC
AAATACCGTCACCACGGTAATGACGGCGACAGAACAAATGGACTGGTTCCATGCCACGTATCAGGAAGCA
TTAAACGCCGCGACCCTTGATCCGGGCAATCCTGAAAAATACCTCACGGTCATGCGTATGCACCATTTCA
TCGGAGAGAAAGTCTCACAGACAGGCATGACGTTTAAGCAGTTGTTGCTCACCCATCCTGAGCTTTCTTA
CGTGCGTGACCGTCCGGTTCAGCAAGCCGCCCGAGGTCCTTACCTTGCTCAGCAGCGGCAGAAGAAAACC
GAGATCGTCACTCAGCTGGTCGACCGGGGGTGGGGGCTGATGTTTGTGTATCGGGGAAACGATGCGATAA
GCCAGAGGCTAGCGCCTTCGTTGCAACAGTTTGCTGACGCACATCAGTTTGAGCTCCTGGGGGTCAGTGA
AGACGACACCTTTATCGACGCGGTGCGCCATAACCGGCGCAATCGTGGAAAAGTGACGGTGCCGTATACG
CCAGCGATCTTGATGGTGCACCCCAAAACGGCGGAGTTCAAACCGTTAGCGTACGGGTTTATCTCACAGT
CCGAACTGCTCAGTCGCGTGTACAACGCCGCGACGGACTACCAGATCCCAGATTTTTAG
 Primer design