SecReT4
Protein ID: 326402568
T4SS name [ID]Trb [342]
Gene symboltraF
Locus tagACMV_04200
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]473665..474204 [+]
Productputative conjugal transfer protein TraF
Component typeTraF
UniProt IDF0J2X8
KEGG IDamv:ACMV_04200
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 3.1e-46, Aligned region: 34..173
Protein Sequence: 179 a.a.     [Download]
>gi|326402568|ref|YP_004282649.1| putative conjugal transfer protein TraF [Acidiphilium multivorum AIU301]
MKRNRRTRHAVLLAMLAALVLLAASAVQARPLVVWNATASTPVGLWRVLPGASRKHLRVGDYVLFWPDRR
SARFFARRGYLPRGVPLLKRVAAIAGQAVCERDGAVSINGRTVARALPVDGRGRSLAAWSGCGKLPNGEI
FVLIPSVPASLDGRYFGPTPIRAVIGRVTPLWFPGGRAR
 
Nucleotide Sequence: 540 bp     [Download]
>gi|326402148|ref|NC_015186.1|:473665-474204 Acidiphilium multivorum AIU301, complete genome
ATGAAGCGGAATCGGCGGACTCGGCATGCCGTGCTCCTCGCCATGCTCGCGGCCCTGGTCTTGCTCGCCG
CTTCAGCGGTGCAGGCACGGCCGCTGGTGGTCTGGAATGCCACCGCCAGCACGCCGGTCGGCCTTTGGCG
CGTGCTGCCGGGCGCGAGCCGGAAGCACCTCCGCGTCGGCGATTACGTGCTGTTCTGGCCCGACCGGCGC
AGCGCGCGGTTCTTCGCCCGGCGCGGCTATCTGCCGCGCGGCGTACCGCTGCTGAAGCGCGTCGCCGCCA
TCGCCGGACAGGCCGTGTGCGAGCGCGACGGCGCGGTTTCGATCAATGGCCGCACCGTCGCCCGCGCCCT
GCCGGTGGACGGACGCGGACGCAGCCTGGCCGCATGGAGCGGCTGCGGCAAGCTCCCGAACGGCGAGATT
TTCGTGCTGATCCCCAGCGTGCCGGCCTCGCTCGACGGGCGGTACTTCGGGCCGACGCCGATCCGCGCCG
TCATCGGCCGCGTCACGCCGCTCTGGTTTCCCGGCGGGCGGGCGCGATGA
 Primer design