SecReT4
Protein ID: 326402569
T4SS name [ID]Trb [342]
Gene symbol-
Locus tagACMV_04210
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]474501..475256 [+]
Producthypothetical protein
Component typeTrbN
UniProt IDF0J2X9
KEGG IDamv:ACMV_04210
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 251 a.a.     [Download]
>gi|326402569|ref|YP_004282650.1| hypothetical protein ACMV_04210 [Acidiphilium multivorum AIU301]
MCGSAAPLLRGHGHEAVAVWRPDIAAAAHRFDIPEAWIAAVMRAESGGQATMDGEPIRSPAGAMGLMQVM
PHTYAALRARYGLGANPYAPRDNILAGAAYLREMLERYGVPWFLAAYNAGPARLDAFLHTGRALPAETQR
YLAALAPQIGGTSGALQTAVGRMGSSTKSAPEAALLGPNDAVSAGLFATVVVHPEASPARTVPPIVSPRL
APMAAPTEVTGGSAAAGLEPRSASGSALNVRGNGALFVVLQ
 
Nucleotide Sequence: 756 bp     [Download]
>gi|326402148|ref|NC_015186.1|:474501-475256 Acidiphilium multivorum AIU301, complete genome
GTGTGCGGAAGTGCGGCGCCCCTATTGCGCGGCCACGGACACGAAGCGGTGGCCGTTTGGCGGCCCGACA
TCGCCGCGGCGGCGCACCGCTTCGACATTCCCGAAGCATGGATTGCCGCCGTGATGCGCGCGGAGAGCGG
CGGCCAGGCGACCATGGACGGCGAGCCAATCCGCTCACCAGCAGGCGCGATGGGCCTGATGCAGGTGATG
CCGCACACCTACGCTGCGCTGCGTGCCCGCTATGGGCTGGGTGCCAATCCGTATGCGCCACGCGACAACA
TCCTCGCCGGCGCGGCGTATCTGCGCGAGATGCTGGAGCGCTACGGCGTGCCCTGGTTCCTCGCTGCCTA
CAACGCCGGGCCGGCGCGGCTCGATGCGTTCTTGCACACCGGCCGCGCGCTGCCGGCCGAGACACAGCGC
TACCTCGCCGCACTCGCGCCGCAGATCGGCGGCACGTCGGGCGCGTTGCAGACGGCAGTCGGGAGGATGG
GATCGAGCACGAAGTCTGCTCCGGAGGCGGCTCTCCTGGGCCCAAACGACGCCGTCAGCGCCGGCCTCTT
CGCGACCGTTGTCGTGCACCCCGAGGCCTCTCCTGCGCGCACTGTCCCGCCGATCGTGAGCCCGAGGCTG
GCGCCGATGGCTGCACCGACGGAGGTCACGGGCGGTTCGGCTGCGGCCGGACTTGAGCCTCGATCTGCCT
CCGGTTCTGCCCTCAATGTGCGCGGAAATGGTGCGCTGTTCGTCGTCCTCCAATGA
 Primer design