SecReT4
Protein ID: 326402573
T4SS name [ID]Trb [342]
Gene symboltraG
Locus tagACMV_04250
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]484079..486088 [+]
Productconjugal transfer protein TraG
Component typeTraG
UniProt IDF0J2Y3
KEGG IDamv:ACMV_04250
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.5e-102, Aligned region: 137..559
TraG-D_C [PF12696], Evalue: 2.5e-32, Aligned region: 407..528
TrwB_AAD_bind [PF10412], Evalue: 2e-28, Aligned region: 170..542
AAA_10 [PF12846], Evalue: 1.3e-08, Aligned region: 146..484
Protein Sequence: 669 a.a.     [Download]
>gi|326402573|ref|YP_004282654.1| conjugal transfer protein TraG [Acidiphilium multivorum AIU301]
MTGTKILWGQMLGALAMVLFGCWAATEWTAWRLGFQPALGLPWVRIGAAPVYQPQLFFAWWYHFDAYAPG
VFARGAAIASAGGLGAALLAIVASVLRARQARHVTTYGSAHWAAHHDIAAAGLFGDAGVQLGRLGAQTLR
HDGPEHVLCFAPTRSGKGVGLVVPTLLSWTGSVIVHDIKGENWTLTSGWRAQFSHCLLFDPTNPRSAAYN
PLLEVRRGEWEVRDVQNIADVLVDPEGALERRNHWEKTSHSLLVGAILHVLYAEPDKTLAGVAAFLSDPA
RPIERTLRAMMTTPHLGARGVHPVVAQSARELLNKSENERSGVLSTAMSFLGLYRDPVVAKVTSHSDWRI
ADLVGAERPVSLYLVVPPSDISRTKPLIRLVLNQIGRRLTETLDVPARRATGHAPSRLLMMLDEFPALGR
LDFFESALAFMAGYGIRAFLIAQSLNQIQKAYGEHDAILDNCHVRVCFATNDERTAKRISDALGTATELR
AMKNYAGHRLAPWLSHLMVSRQETARPLLTPGEVMQLPPTDEIVMVAGLPPIRAKKLRYYEESAFRDRVL
LTPTLSERGYPDIPQARGDDWTGAGPIGAQAADSAEAVLPDPANGGIRQEPELPEHEAIVPAREPAGEFA
ILEDEPDDEPQRQRAMAALQRQTVRNAAIDRGDGMAMGM
 
Nucleotide Sequence: 2010 bp     [Download]
>gi|326402148|ref|NC_015186.1|:484079-486088 Acidiphilium multivorum AIU301, complete genome
ATGACCGGGACGAAGATTCTCTGGGGCCAGATGCTGGGCGCACTCGCCATGGTGCTGTTCGGCTGCTGGG
CCGCCACGGAATGGACGGCTTGGCGGCTTGGCTTCCAGCCGGCACTCGGCTTGCCCTGGGTCCGAATTGG
CGCGGCGCCGGTCTATCAGCCGCAGCTGTTCTTCGCGTGGTGGTACCATTTCGACGCCTACGCCCCCGGC
GTCTTCGCCAGAGGCGCGGCGATCGCCTCCGCCGGGGGTCTGGGCGCGGCGCTACTCGCCATCGTGGCCT
CGGTCCTTCGCGCACGCCAGGCGCGGCACGTCACCACCTATGGCTCAGCGCATTGGGCAGCGCACCACGA
CATCGCGGCGGCGGGCCTGTTCGGTGACGCCGGCGTGCAGCTTGGCCGGCTCGGCGCGCAGACCCTCCGC
CATGACGGCCCGGAGCACGTGCTCTGCTTCGCCCCGACGCGCTCGGGCAAGGGCGTCGGCCTGGTCGTGC
CGACGCTGCTGTCATGGACCGGCAGCGTCATCGTCCACGACATCAAGGGCGAGAATTGGACCCTGACCTC
CGGCTGGCGCGCCCAGTTCAGCCACTGCCTGCTGTTCGACCCGACCAACCCGCGCTCCGCCGCCTACAAC
CCGCTGCTGGAGGTCCGCCGCGGCGAATGGGAAGTGCGCGACGTCCAGAACATCGCCGATGTGCTGGTCG
ATCCCGAGGGCGCGCTGGAACGTCGCAACCACTGGGAGAAGACCAGCCACTCGCTGCTGGTCGGTGCCAT
CCTGCATGTGCTCTACGCCGAGCCGGACAAGACGCTGGCCGGCGTCGCCGCGTTCCTCTCCGATCCGGCG
CGGCCCATCGAGCGGACCTTGCGGGCGATGATGACCACGCCGCATCTCGGCGCGCGTGGTGTCCATCCGG
TGGTCGCGCAGTCGGCCCGTGAGCTGCTCAACAAGTCCGAGAACGAGCGCTCCGGCGTGCTCAGCACGGC
GATGTCGTTTCTCGGCCTCTACCGCGATCCGGTGGTGGCCAAGGTGACGTCCCACTCGGATTGGCGGATC
GCCGATCTGGTCGGTGCCGAGCGGCCGGTGTCGCTTTACCTCGTCGTGCCGCCATCGGACATCTCGCGCA
CGAAGCCGCTGATCCGCCTGGTGCTCAACCAGATCGGCCGGCGGCTGACCGAGACCCTGGACGTTCCCGC
GCGACGCGCGACGGGCCACGCACCGTCGCGTCTGCTGATGATGCTCGACGAGTTTCCTGCGCTCGGCCGG
CTGGATTTCTTCGAATCCGCGCTCGCTTTCATGGCCGGGTACGGCATCCGCGCCTTCCTGATCGCGCAGT
CGCTCAACCAGATCCAGAAGGCCTATGGCGAGCACGACGCGATCCTGGACAACTGCCATGTCCGCGTTTG
TTTCGCGACCAACGACGAGCGGACCGCCAAGCGCATCTCGGATGCGCTCGGCACCGCGACCGAACTCCGG
GCGATGAAGAACTACGCCGGCCATCGGCTGGCGCCGTGGTTGTCGCATCTGATGGTCAGCCGTCAGGAGA
CCGCGCGCCCGCTGCTGACCCCGGGCGAGGTGATGCAACTGCCGCCGACCGACGAGATCGTCATGGTCGC
CGGCCTGCCGCCGATCCGTGCGAAGAAGCTGCGCTACTATGAAGAGTCGGCATTCCGGGACCGGGTGTTG
CTGACGCCGACGCTGTCGGAGCGCGGCTACCCGGACATCCCACAGGCCCGAGGCGACGACTGGACCGGCG
CGGGGCCGATCGGTGCCCAGGCTGCGGATTCCGCCGAGGCGGTGCTCCCGGACCCCGCCAATGGTGGCAT
CCGCCAGGAGCCGGAACTGCCGGAGCACGAAGCCATCGTGCCAGCCCGCGAGCCGGCTGGCGAGTTCGCC
ATCCTGGAGGACGAGCCCGACGACGAGCCGCAGCGCCAGCGCGCCATGGCGGCGCTGCAACGGCAAACCG
TGCGCAACGCGGCGATCGACCGCGGCGACGGCATGGCGATGGGGATGTAG
 Primer design