SecReT4
Protein ID: 326402575
T4SS name [ID]Trb [342]
Gene symboltrbB
Locus tagACMV_04270
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]486594..487601 [+]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDF0J2Y5
KEGG IDamv:ACMV_04270
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.4e-84, Aligned region: 25..290
TrwB_AAD_bind [PF10412], Evalue: 1e-05, Aligned region: 147..184
Protein Sequence: 335 a.a.     [Download]
>gi|326402575|ref|YP_004282656.1| conjugal transfer protein TrbB [Acidiphilium multivorum AIU301]
MPVSDGTSMMLARSVRMLRTALGPAIATLLGQPDIVEVMLNPDGRLWVDRLGAGLADTGLRMLPADGERI
IRLVAHHVGVEAHAHNPRISAELPETGERFEGLLPPVVTGPTFAIRKPAIAVFSLHDYVETGIMRADQAG
LLRTAIAERWNILVAGGTSTGKTTLTNALLKEVAATGDRVVVIEDTRELQVEAPNLVSLRTKDGVCSLAD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGGIGTIHAGSALGALRRLEQLIQEAVVNVPRPLIA
ETIDLIAVLHGRGRHRRLAGLWQVGKVLAAGDYVLTEIGAERPSNIVPLQPGSHP
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|326402148|ref|NC_015186.1|:486594-487601 Acidiphilium multivorum AIU301, complete genome
ATGCCGGTCTCTGACGGCACCAGCATGATGCTGGCCCGCTCGGTGCGCATGCTGCGCACCGCGCTCGGTC
CGGCGATCGCGACGCTGCTGGGGCAGCCCGACATCGTCGAGGTGATGCTCAACCCGGACGGCCGGCTCTG
GGTGGACCGTCTCGGCGCCGGCCTTGCCGACACCGGCCTGCGGATGCTGCCCGCCGACGGCGAGCGCATT
ATCCGTCTCGTCGCGCACCACGTGGGCGTCGAGGCACACGCCCATAATCCGCGCATCTCGGCCGAACTGC
CGGAGACCGGCGAGCGCTTCGAGGGCCTGCTGCCGCCGGTGGTGACCGGCCCTACTTTCGCCATCCGCAA
GCCCGCCATCGCGGTGTTCTCGCTCCACGACTACGTCGAGACCGGGATCATGCGCGCCGACCAGGCCGGG
CTGCTGCGAACGGCGATCGCCGAACGCTGGAACATCCTGGTCGCCGGCGGCACCTCGACCGGCAAGACGA
CACTGACCAACGCGCTGCTCAAGGAAGTCGCCGCCACCGGCGACCGCGTTGTAGTCATCGAGGACACGCG
GGAACTCCAGGTCGAGGCGCCGAACCTCGTGTCGCTGCGAACGAAGGATGGCGTCTGCTCCCTCGCGGAT
CTGGTCCGCTCCAGCCTGCGGCTGCGTCCCGACCGCATCCCGATCGGCGAGGTACGCGGTGCCGAGGCGC
TCGACCTGCTGAAGGCCTGGGGCACCGGCCATCCCGGCGGCATCGGCACCATCCATGCCGGCTCGGCCCT
CGGCGCGCTGCGCCGGCTCGAACAGCTGATCCAGGAGGCGGTGGTCAACGTGCCGCGCCCGTTGATCGCG
GAGACCATCGATCTGATCGCGGTTTTGCACGGCCGCGGCCGGCACCGCCGCCTCGCCGGGCTCTGGCAGG
TCGGCAAGGTCCTGGCCGCTGGCGACTACGTGCTGACGGAGATCGGCGCCGAGCGCCCGTCCAACATCGT
TCCCCTCCAGCCCGGGAGTCATCCGTGA
 Primer design