SecReT4
Protein ID: 326402576
T4SS name [ID]Trb [342]
Gene symboltrbC
Locus tagACMV_04280
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]487598..487930 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDF0J2Y6
KEGG IDamv:ACMV_04280
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.2e-25, Aligned region: 7..100
Protein Sequence: 110 a.a.     [Download]
>gi|326402576|ref|YP_004282657.1| conjugal transfer protein TrbC [Acidiphilium multivorum AIU301]
MSPNTIIHARRPHTAALIALVLLWPVSALAAGSNMPWEQPLQQILDSVQGPVAKIIAVLIIIGTGLGLAF
GETSGGMRRLIQIVFGLSIAFAAASFFLTFFNFSGGALVG
 
Nucleotide Sequence: 333 bp     [Download]
>gi|326402148|ref|NC_015186.1|:487598-487930 Acidiphilium multivorum AIU301, complete genome
GTGAGCCCGAACACGATCATCCACGCCCGGCGTCCGCACACAGCCGCGCTCATCGCGCTGGTGCTGCTCT
GGCCGGTCTCCGCTCTCGCGGCGGGATCTAACATGCCGTGGGAGCAACCGCTGCAGCAGATCCTCGATTC
CGTGCAGGGGCCGGTCGCGAAAATCATCGCCGTGCTGATCATCATCGGCACCGGTCTCGGTCTCGCTTTC
GGTGAAACTTCCGGCGGCATGCGCCGGCTGATCCAGATCGTCTTCGGTCTGTCGATCGCCTTCGCCGCCG
CAAGCTTCTTCCTGACCTTCTTCAACTTCTCCGGTGGGGCGCTGGTCGGATGA
 Primer design