SecReT4
Protein ID: 326402577
T4SS name [ID]Trb [342]
Gene symbol-
Locus tagACMV_04290
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]487927..488199 [+]
Producthypothetical protein
Component typeTrbD
UniProt IDF0J2Y7
KEGG IDamv:ACMV_04290
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8.1e-10, Aligned region: 12..82
Protein Sequence: 90 a.a.     [Download]
>gi|326402577|ref|YP_004282658.1| hypothetical protein ACMV_04290 [Acidiphilium multivorum AIU301]
MNGPADLPGWSVPLHRSLTEPILLGGVPRGMAIALGTLSAAIGLGLQLWIAGIAIYLIGHAAALFLTRQD
PQFGPVFARHLRAARRHLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|326402148|ref|NC_015186.1|:487927-488199 Acidiphilium multivorum AIU301, complete genome
ATGAACGGTCCCGCGGACCTTCCCGGCTGGTCGGTGCCGCTGCATCGCAGCCTGACCGAGCCGATCCTGC
TGGGCGGCGTGCCGCGCGGCATGGCGATCGCGCTCGGCACGCTATCGGCCGCGATCGGGCTTGGCCTCCA
GCTCTGGATCGCCGGGATTGCGATCTACCTGATCGGCCATGCCGCGGCACTGTTCCTGACCCGTCAGGAC
CCGCAATTCGGGCCGGTGTTCGCCCGGCATCTGCGCGCCGCGCGGCGCCATCTGGACGTGTGA
 Primer design