SecReT4
Protein ID: 326402578
T4SS name [ID]Trb [342]
Gene symboltrbE
Locus tagACMV_04300
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]488217..490838 [+]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDF0J2Y8
KEGG IDamv:ACMV_04300
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.3e-32, Aligned region: 454..725
CagE_TrbE_VirB [PF03135], Evalue: 3.8e-18, Aligned region: 239..400
Protein Sequence: 873 a.a.     [Download]
>gi|326402578|ref|YP_004282659.1| conjugal transfer protein TrbE [Acidiphilium multivorum AIU301]
MLDLREYRTRRRELADFLPWAGLVGPGIVLNKDGALQRTARFRGPDLDASTPAELIAVAARVNNALKRLG
EGWAIFVEAARSAAPGYPESRFPDPVSWLIDEERRHAFQEEGVHFESGYFLTFCFLAPPERAEQASRLLY
DRGDVQHRRAQGAGESGGVDWRATLDAFAAETDRVLDLLAALMPDCTWLDDAGTLAYLHFTISTNGPHPV
GVPEVPFYLDGLLPDCDLTPGVAPMLGRYYLRTLTLRGLPDRTWPGLLDELNRLPIEYRWVARWLPLEKA
EAQKELGKKRRHWWAKRKGIAALLREVIWQQETRLVDSDAENQSVDADAALQELGSDAVSFGYFTATVTV
WDTDEAAAIEKVRLVGRAVRAQGFVAVEETLNAVEAWLGSLPGQCYANIRQPLVSSLNLVHMLPLSAVWA
GPERNAHLDGPPLLVAHTAGSTPFRLVPHQGDVGHTLIVGPTGAGKSVLLALIALQFRRYPGARVVIFDK
GRSSKAAVVGMGGAFHDLGLGGEVSYQHQQAVAFQPLARIDDAAERAWAADWIATLLVQESIELTPEVRG
AIWSALGSLATAPVPERTLSGFTALLQVNRLKAALEPYTIAGPFDRLLDAEQESVADADVLAFETEDLLG
SKHAARAVLTYLFHRIEAGLDGRPTLIAVDEAWFALDDPVFAPKLREWLKTLRRKNASVLFSTQSLADIT
RSPVAPAVIESCLSRIFLPNARAIEPESHDAYARLGLNDRQIETIARAVPKRDYWVQSAAGCRLFELGLG
EIALAFCGASRAEDLAAIDRVLGRHGLAAFPAAWLRERGLDWAAALIAPGIATATNLPDASAAIGEAASL
ADIGPDPAQPMLPFGDGAAWSAEPAYPVTETIP
 
Nucleotide Sequence: 2622 bp     [Download]
>gi|326402148|ref|NC_015186.1|:488217-490838 Acidiphilium multivorum AIU301, complete genome
ATGCTCGACCTCCGGGAATATCGCACCAGGCGCCGGGAACTCGCCGACTTCCTCCCCTGGGCCGGCTTGG
TTGGTCCGGGGATCGTGCTCAACAAGGACGGTGCACTCCAGCGCACCGCAAGGTTCCGCGGGCCGGACCT
CGATGCCAGCACGCCGGCCGAGCTGATCGCAGTCGCCGCACGGGTCAACAACGCGCTCAAACGCCTCGGC
GAGGGCTGGGCGATCTTCGTCGAGGCAGCGCGCTCCGCCGCGCCCGGCTATCCCGAGAGCCGCTTCCCCG
ATCCGGTGTCCTGGCTGATCGACGAGGAGCGGCGGCACGCCTTCCAAGAGGAGGGTGTGCATTTCGAGAG
CGGATATTTCCTGACCTTCTGCTTCCTCGCGCCGCCCGAGCGCGCCGAACAGGCCAGCCGGCTGCTCTAC
GACCGGGGCGATGTCCAGCATCGACGTGCCCAAGGCGCGGGCGAGTCCGGCGGCGTCGACTGGCGCGCCA
CCCTGGACGCCTTCGCAGCCGAGACCGACCGCGTGCTCGACCTGCTGGCCGCCCTCATGCCGGACTGCAC
CTGGCTCGATGACGCCGGCACGCTGGCCTATCTGCACTTCACGATCTCGACCAACGGGCCGCACCCGGTG
GGCGTGCCCGAAGTGCCCTTCTATCTCGACGGGCTGCTGCCGGATTGCGATCTAACGCCCGGCGTCGCCC
CGATGCTCGGGCGCTACTATCTCCGCACGCTCACCCTGCGCGGCCTGCCGGACCGCACGTGGCCAGGGCT
GCTCGACGAACTCAATCGGCTTCCGATCGAATACCGCTGGGTCGCGCGCTGGCTGCCGCTCGAGAAAGCC
GAGGCGCAGAAGGAACTTGGCAAGAAGCGCCGGCACTGGTGGGCCAAGCGCAAGGGCATCGCCGCGCTAC
TGCGCGAGGTGATCTGGCAGCAGGAGACCCGGCTGGTCGATTCCGACGCCGAGAACCAGTCGGTGGACGC
CGATGCGGCCCTGCAGGAACTCGGCTCGGACGCGGTCAGCTTCGGGTATTTCACCGCGACGGTGACGGTC
TGGGATACCGACGAAGCCGCTGCCATCGAGAAGGTCCGGCTGGTCGGCCGCGCGGTGCGTGCGCAGGGAT
TCGTCGCGGTCGAGGAGACGCTGAACGCGGTCGAGGCCTGGCTCGGGAGCCTGCCCGGGCAGTGCTACGC
CAATATCCGCCAGCCGCTGGTCTCGTCGCTGAACCTCGTCCACATGCTGCCACTCTCGGCGGTCTGGGCC
GGGCCGGAGCGCAACGCGCATCTCGACGGCCCGCCGCTGCTGGTGGCGCACACCGCGGGCTCGACACCGT
TCCGCCTCGTGCCGCACCAAGGGGATGTCGGCCACACCTTGATCGTCGGCCCCACCGGCGCGGGCAAGAG
CGTGCTGCTCGCGCTGATCGCGCTGCAGTTCCGCCGTTACCCCGGCGCGCGCGTGGTGATCTTCGACAAG
GGTCGTTCGTCCAAGGCCGCCGTGGTCGGCATGGGCGGCGCCTTCCACGACCTCGGACTCGGCGGCGAGG
TTTCGTACCAGCATCAGCAGGCCGTTGCCTTCCAGCCGCTGGCGCGCATCGACGATGCGGCCGAGCGTGC
CTGGGCGGCAGACTGGATCGCGACCCTGCTTGTCCAGGAAAGCATCGAGCTGACGCCGGAAGTCCGCGGC
GCCATCTGGTCGGCGCTCGGCTCACTCGCCACCGCCCCGGTGCCCGAGCGCACGCTGTCGGGCTTCACCG
CCCTGTTGCAGGTCAATCGGCTCAAGGCGGCGCTCGAACCCTACACCATCGCCGGCCCGTTCGACCGTCT
GCTGGATGCCGAGCAGGAGAGCGTCGCTGACGCCGACGTGCTGGCCTTCGAGACCGAGGATCTCCTCGGC
TCGAAGCACGCGGCCCGCGCCGTGCTGACCTATTTGTTTCACCGCATCGAGGCGGGGCTGGACGGGCGGC
CGACCTTGATCGCGGTGGACGAGGCGTGGTTCGCGCTCGACGATCCGGTCTTCGCGCCGAAGCTGCGCGA
GTGGCTGAAGACTCTGCGGCGGAAGAATGCCTCCGTGCTGTTCTCGACCCAGAGCCTCGCCGACATCACG
CGCTCGCCCGTGGCACCGGCCGTCATCGAGAGCTGTCTCTCCCGCATCTTCCTGCCGAACGCGCGGGCGA
TCGAACCGGAGAGCCACGACGCCTACGCCCGCCTCGGCCTGAATGACCGGCAGATCGAGACGATCGCGCG
CGCGGTGCCGAAGCGGGACTACTGGGTCCAGTCCGCCGCCGGCTGCCGGCTGTTCGAACTCGGCCTCGGC
GAGATCGCGCTCGCCTTCTGTGGCGCGAGCCGCGCAGAGGACCTGGCCGCAATTGATCGCGTGCTGGGAA
GGCATGGGCTCGCGGCGTTCCCGGCAGCGTGGCTGCGCGAGCGGGGGCTCGACTGGGCAGCGGCGCTGAT
CGCGCCTGGAATCGCAACCGCGACGAATCTCCCGGACGCCTCTGCGGCCATCGGTGAAGCCGCGTCCCTC
GCCGATATCGGACCCGATCCCGCGCAACCCATGCTGCCATTCGGAGATGGTGCCGCTTGGTCCGCGGAGC
CGGCATATCCTGTGACGGAGACGATCCCATGA
 Primer design