SecReT4
Protein ID: 326402579
T4SS name [ID]Trb [342]
Gene symboltrbJ
Locus tagACMV_04310
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]490835..491617 [+]
ProductP-type conjugative transfer protein TrbJ
Component typeTrbJ
UniProt IDF0J2Y9
KEGG IDamv:ACMV_04310
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 260 a.a.     [Download]
>gi|326402579|ref|YP_004282660.1| P-type conjugative transfer protein TrbJ [Acidiphilium multivorum AIU301]
MIHAWLKRTGTRVVGNALIGALLAISPVLPASATVPVIDIANLSQNVLTAARTLAEVNNQITQIQQGISM
LENQARNLTTLPFSALAELQSSMGQIDRLMGQAQGLAYTVQQVQAQFQQLYPNYQSANFQGNVTQAGLLA
DANARWQASVSTFQHTMEVQSQIVASIPSDQADLSALVGQSQGAVGALQAIQASNQLLALQARQLSATQD
LIAADARAQAANAMQNAEARSAAEADWKRFYGNGVSYTPTPVNVFGGPAP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|326402148|ref|NC_015186.1|:490835-491617 Acidiphilium multivorum AIU301, complete genome
ATGATCCATGCTTGGCTCAAGCGCACTGGCACGCGAGTGGTTGGCAACGCCTTGATCGGTGCGCTGCTGG
CAATCTCCCCTGTGCTGCCCGCCAGTGCGACCGTGCCGGTGATCGACATCGCCAACCTGTCGCAGAATGT
GCTGACGGCGGCACGCACTTTGGCGGAGGTGAACAATCAGATCACCCAGATCCAGCAGGGCATCTCCATG
CTGGAGAACCAGGCGCGGAACCTGACGACGCTGCCGTTCTCGGCGCTGGCCGAGCTGCAATCCTCCATGG
GGCAGATCGACCGGCTCATGGGGCAGGCGCAAGGCCTCGCTTACACGGTGCAGCAGGTCCAGGCTCAGTT
CCAGCAGCTCTATCCGAACTACCAGTCCGCAAACTTTCAAGGAAATGTCACACAGGCCGGTCTGTTGGCG
GACGCCAACGCGCGCTGGCAGGCATCGGTCAGCACGTTCCAGCACACCATGGAGGTGCAGAGCCAGATCG
TCGCTTCGATACCCTCCGATCAGGCAGACTTGTCCGCGCTCGTCGGCCAGAGCCAGGGGGCGGTTGGTGC
ATTGCAGGCGATCCAGGCGAGCAATCAGCTTCTGGCTTTGCAAGCACGCCAGCTCTCCGCGACACAGGAT
CTGATCGCTGCTGATGCCCGCGCGCAGGCCGCCAATGCGATGCAGAACGCGGAGGCGCGCTCGGCCGCGG
AGGCGGACTGGAAGCGCTTCTACGGCAATGGCGTGAGCTATACTCCGACCCCGGTCAACGTGTTCGGAGG
ACCCGCACCATGA
 Primer design