SecReT4
Protein ID: 326402581
T4SS name [ID]Trb [342]
Gene symboltrbL
Locus tagACMV_04330
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]491930..493228 [+]
ProductP-type conjugative transfer protein TrbL
Component typeTrbL
UniProt IDF0J2Z1
KEGG IDamv:ACMV_04330
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-38, Aligned region: 38..262
Protein Sequence: 432 a.a.     [Download]
>gi|326402581|ref|YP_004282662.1| P-type conjugative transfer protein TrbL [Acidiphilium multivorum AIU301]
MGSNTSVIDHFLNVFSNYINSGFGLISPDVGFLVAVLIGIDATLAGLAWALGEDDAIQTLAKKVLYVGFF
AFILNNWPLLTQLVFNSFAALGLKATGSSLSYANFLQPGRLAQAGVQGADVLLSQIQRLAGFPDFFWNLG
QILVMGLSWIVTLLGFFVLAILLFLAIIEFKLTTLKGFILVPFALWRGTAFIAEPVLGQIVTSGVRILVF
AVITGIGTQLFGQILPSNPATELSLQDALTILLASMTIAGLAFSANRLAAGITSGAPQLGLGSAAAAGGA
VAGAAALAGMGGVAAARALAGGVGAAASLAGGASGAYTLGSATGGGSVSAGLAGVARGAAGAATSGLRGT
AQTASTALRDRFATGQRAAWSATGGSGGDAAVTSPSAAAPSGAPAWAQRLRRQAVSRAAQNILHEAEGHG
GGMRPNLRGDGT
 
Nucleotide Sequence: 1299 bp     [Download]
>gi|326402148|ref|NC_015186.1|:491930-493228 Acidiphilium multivorum AIU301, complete genome
ATGGGTAGCAACACGTCCGTCATCGACCACTTCCTCAACGTCTTCAGCAACTACATCAATTCAGGGTTCG
GCCTGATCTCCCCTGACGTCGGGTTTCTCGTCGCCGTGCTGATTGGGATTGACGCGACGTTGGCCGGTCT
CGCCTGGGCGCTCGGCGAGGACGACGCCATCCAGACGCTCGCAAAGAAGGTCCTGTACGTCGGCTTTTTC
GCCTTCATCCTGAATAATTGGCCTTTGCTTACGCAACTCGTCTTCAACAGTTTTGCCGCACTTGGTCTGA
AGGCGACCGGCTCTTCGCTTTCCTACGCGAACTTCCTCCAGCCCGGCCGCCTCGCCCAGGCCGGCGTGCA
GGGTGCGGACGTCCTCCTCTCCCAGATCCAGCGCCTCGCCGGGTTTCCAGACTTCTTCTGGAACCTCGGC
CAGATCTTGGTCATGGGTCTGTCCTGGATCGTCACTCTGCTCGGGTTCTTCGTGCTCGCGATCCTGCTGT
TCCTGGCGATCATCGAATTCAAGCTGACCACGCTGAAGGGCTTCATCCTGGTCCCCTTCGCGCTCTGGCG
CGGCACCGCTTTCATTGCCGAGCCAGTACTCGGCCAGATCGTCACCTCCGGTGTGCGCATCCTCGTCTTC
GCGGTGATCACCGGCATCGGCACCCAGCTCTTCGGCCAGATCCTGCCGAGCAACCCGGCGACCGAACTCT
CGCTCCAGGACGCGCTCACCATTCTGCTCGCCTCGATGACCATCGCCGGGCTGGCCTTCTCGGCGAACCG
GCTTGCCGCCGGCATCACCTCTGGCGCACCGCAACTGGGCCTTGGCAGCGCCGCCGCCGCGGGCGGTGCT
GTCGCCGGCGCTGCGGCCCTGGCCGGGATGGGAGGGGTGGCAGCCGCCCGCGCCCTGGCCGGCGGCGTCG
GTGCCGCGGCTTCACTCGCCGGCGGCGCGAGCGGTGCCTATACGCTCGGCAGCGCCACCGGCGGCGGGTC
GGTTTCCGCCGGCCTGGCCGGTGTCGCTCGCGGGGCGGCCGGTGCGGCCACCAGCGGTCTGCGAGGTACG
GCCCAGACTGCCTCGACGGCGCTGCGCGATCGCTTCGCCACCGGCCAACGCGCCGCCTGGTCGGCCACCG
GCGGATCGGGCGGAGATGCTGCCGTCACATCCCCGTCCGCAGCGGCTCCCAGCGGTGCACCGGCCTGGGC
CCAGCGCCTGCGACGGCAAGCCGTCTCCCGGGCGGCGCAGAACATCCTCCACGAAGCCGAAGGCCACGGT
GGCGGCATGCGGCCCAATTTGCGCGGGGACGGAACATGA
 Primer design