SecReT4
Protein ID: 326402582
T4SS name [ID]Trb [342]
Gene symboltrbF
Locus tagACMV_04340
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]493225..493935 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDF0J2Z2
KEGG IDamv:ACMV_04340
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.5e-48, Aligned region: 22..225
Protein Sequence: 236 a.a.     [Download]
>gi|326402582|ref|YP_004282663.1| conjugal transfer protein TrbF [Acidiphilium multivorum AIU301]
MRWRRFSSRLGDTEAPATPYQRAGQLWDQRIGSARVQAANWRLMAFGCLALAAVVTADDIRTHSRAMVTP
FIVEVDHLGAVQAIAPARVEVQPTDTEIAYFLAQFIERVRGLSVDPVVVRQAWLDAYAQITSRAKPMLDA
YARQADPFGQIGKRAVTVDVTSVVRASPNSFRVAWVEHPFQDGTALQPEHWTAILTVVIQTPHTEAALRQ
NPLGIYIDAISWAREVNTTQTEGSTP
 
Nucleotide Sequence: 711 bp     [Download]
>gi|326402148|ref|NC_015186.1|:493225-493935 Acidiphilium multivorum AIU301, complete genome
ATGAGGTGGCGCCGCTTCTCCTCCCGTCTCGGCGACACCGAGGCGCCGGCCACGCCCTATCAGCGCGCCG
GGCAACTGTGGGACCAGAGAATCGGCTCTGCCCGCGTGCAGGCCGCGAACTGGCGCCTGATGGCGTTCGG
CTGCCTGGCGCTCGCCGCGGTCGTCACCGCCGATGACATCCGCACGCATTCCCGCGCCATGGTCACCCCG
TTCATCGTCGAGGTCGATCATCTCGGCGCGGTGCAGGCGATCGCCCCTGCGCGGGTGGAGGTGCAGCCGA
CCGATACCGAGATCGCCTACTTCCTGGCGCAGTTCATCGAGCGCGTGCGCGGCCTCTCGGTCGATCCTGT
CGTCGTCCGCCAAGCCTGGCTCGACGCCTATGCGCAGATCACCAGCCGCGCCAAGCCGATGCTCGACGCC
TATGCCCGTCAGGCCGATCCATTCGGCCAGATCGGCAAGCGCGCCGTGACCGTGGACGTCACCAGCGTCG
TCCGCGCCAGCCCGAATTCCTTCCGCGTCGCCTGGGTCGAGCATCCGTTCCAGGACGGCACTGCACTGCA
ACCCGAGCACTGGACCGCGATCCTGACCGTGGTGATCCAGACCCCGCACACCGAGGCGGCGCTGCGACAG
AACCCGCTCGGCATCTACATCGATGCGATTAGCTGGGCGCGCGAGGTGAACACCACCCAGACCGAAGGAT
CGACGCCATGA
 Primer design