SecReT4
Protein ID: 326402583
T4SS name [ID]Trb [342]
Gene symboltrbG
Locus tagACMV_04350
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]493932..494912 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF0J2Z3
KEGG IDamv:ACMV_04350
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.2e-64, Aligned region: 98..321
Protein Sequence: 326 a.a.     [Download]
>gi|326402583|ref|YP_004282664.1| P-type conjugative transfer protein TrbG [Acidiphilium multivorum AIU301]
MRFSFALACGGALALSACAQPVPKIAYDNPQPAHLVPSPPAPVQVVTWPEPLPLPGQLKKVPRASASRVP
AQPANPIVRVAQANAAARINPTRDGYINAMQVFPWSDGALYEIYASPLHVTDIALQPGEHLISIAAGDTV
QWKIGNTTSGAGADQQVHVLIKPISADLPMNNIVIMTDRRAYHLEVHPTKDTYMAAVSWNYPQDDLLALR
TQNAAATDYANTVAANDVNIAALHFRYRLSGDDPPWRPVQVFDDGSKVYVQFPPGIAQGDMPPLFILGAP
GGKAEIVNYRVRGHTMIVDRLFAAAELRLGAGPQQVVRITRTDGHN
 
Nucleotide Sequence: 981 bp     [Download]
>gi|326402148|ref|NC_015186.1|:493932-494912 Acidiphilium multivorum AIU301, complete genome
ATGAGGTTTTCGTTCGCCCTCGCGTGTGGCGGTGCGTTGGCACTTTCGGCCTGCGCCCAGCCCGTGCCGA
AGATCGCTTACGACAACCCGCAGCCGGCGCATCTCGTGCCGTCGCCGCCGGCCCCGGTTCAGGTCGTGAC
CTGGCCCGAGCCACTGCCGCTGCCGGGGCAGCTCAAGAAAGTGCCGCGGGCCTCGGCGAGCCGGGTGCCA
GCGCAGCCCGCAAATCCGATCGTTCGCGTGGCCCAGGCCAACGCCGCGGCGCGCATCAACCCGACGCGCG
ACGGCTACATCAACGCCATGCAGGTGTTCCCCTGGTCGGACGGGGCGCTGTACGAAATCTACGCCTCGCC
GCTGCACGTGACCGACATCGCGCTCCAGCCCGGCGAGCATCTGATCTCGATCGCGGCTGGCGACACCGTG
CAATGGAAGATCGGCAACACCACCAGCGGCGCGGGGGCCGATCAGCAGGTGCATGTGCTGATCAAACCGA
TTTCGGCGGACCTGCCGATGAACAACATCGTCATCATGACCGATCGGCGCGCCTATCACCTCGAGGTGCA
TCCGACCAAGGACACCTACATGGCCGCGGTGTCCTGGAATTATCCGCAGGACGATCTGCTAGCATTACGG
ACGCAGAACGCCGCGGCGACGGATTACGCGAACACCGTGGCGGCGAATGATGTGAACATCGCGGCGCTGC
ATTTCCGGTATCGGCTCAGCGGCGATGATCCGCCCTGGCGGCCGGTGCAGGTCTTCGATGATGGCTCGAA
GGTCTATGTCCAGTTCCCGCCGGGGATCGCCCAGGGCGACATGCCGCCGCTGTTCATCCTCGGCGCGCCG
GGCGGCAAGGCGGAGATCGTCAATTACCGCGTGCGCGGCCACACCATGATCGTCGATCGGCTGTTCGCCG
CCGCCGAACTTCGCCTCGGCGCCGGGCCGCAGCAGGTCGTGCGCATCACGCGGACCGATGGGCACAACTG
A
 Primer design