SecReT4
Protein ID: 326402584
T4SS name [ID]Trb [342]
Gene symboltrbI
Locus tagACMV_04360
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]494912..496171 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDF0J2Z4
KEGG IDamv:ACMV_04360
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 6.1e-62, Aligned region: 229..413
Protein Sequence: 419 a.a.     [Download]
>gi|326402584|ref|YP_004282665.1| conjugal transfer protein TrbI [Acidiphilium multivorum AIU301]
MADPDDAEPGQRPAPKAAPADFALRARPRAVTRLSRRVLIVAAGGVAVCVVGAVWWAFALHSFRITTGKE
LYNTDVRPSPDVIGGLQNGYASLTKPKPLPAPPRAVPRLGPPLPGDLGRPMLGQGAPTAFAAPPNGADQA
AARLRAQAADAGVFFTVAANTGGTNGAAGTASGALPAGEPAPGPASGNGALAGPHGDQNQQDAKQAFLNS
PVDRAIYSPDRLQAPLSPYELMAGTVIPAALITGLNSDLPGQVIAQVTQDVYDSVSGRTLLVPQGAKLIG
KYDSVVAYGQSRVLLIWTRLIMPDGSSVVLDNLPGADTQGYAGLEDGVDYHFWRLLRGVALSSLLGVSSA
LATNNVVGGTGTGNVIIALGQSADQAANQAGQSIVSRDLGVQPTLTVRPGFPLDVMVNRDIVLRPYGRG
 
Nucleotide Sequence: 1260 bp     [Download]
>gi|326402148|ref|NC_015186.1|:494912-496171 Acidiphilium multivorum AIU301, complete genome
ATGGCGGATCCTGATGACGCGGAGCCTGGGCAGCGACCGGCACCCAAGGCTGCTCCGGCCGACTTTGCGC
TGCGGGCGCGGCCGCGTGCAGTGACGCGCCTCTCGCGTCGGGTGCTGATTGTTGCAGCTGGCGGCGTAGC
GGTCTGCGTGGTGGGGGCGGTCTGGTGGGCGTTCGCGCTGCACAGCTTCCGGATCACCACCGGCAAGGAG
CTCTACAACACGGATGTCCGGCCCTCGCCCGATGTGATTGGCGGCCTGCAGAACGGCTATGCCAGCCTGA
CCAAGCCCAAGCCGCTGCCGGCGCCCCCGCGAGCGGTGCCCCGGCTCGGTCCACCGCTGCCGGGCGATCT
CGGCCGGCCGATGTTGGGGCAAGGGGCGCCCACCGCCTTCGCGGCGCCACCAAATGGTGCGGACCAAGCC
GCGGCACGGCTGCGCGCCCAGGCCGCCGATGCGGGGGTGTTCTTCACCGTGGCGGCGAATACCGGCGGCA
CCAACGGTGCAGCCGGCACCGCGTCAGGTGCCCTGCCAGCCGGCGAGCCCGCTCCCGGACCTGCGAGCGG
TAACGGCGCACTCGCCGGGCCGCATGGCGACCAGAACCAGCAGGACGCCAAGCAGGCGTTCCTGAACAGT
CCGGTCGATCGCGCGATCTATTCGCCCGACCGGCTGCAAGCCCCGCTCAGCCCCTACGAGCTGATGGCCG
GCACCGTGATACCGGCGGCGCTGATCACCGGCCTGAACTCCGACCTGCCGGGGCAGGTGATCGCCCAGGT
GACGCAGGACGTCTATGACAGCGTCTCCGGCCGCACCCTGCTGGTCCCCCAGGGCGCGAAGCTGATCGGC
AAATACGACAGTGTCGTCGCCTACGGGCAGTCACGGGTGCTGCTCATCTGGACACGGCTGATCATGCCCG
ACGGCAGTTCTGTGGTACTCGACAACCTGCCCGGCGCCGACACCCAGGGCTATGCGGGTCTCGAGGACGG
CGTCGATTACCATTTCTGGCGGTTGCTGCGCGGCGTCGCGCTGTCCTCGCTGCTCGGGGTCTCCAGCGCG
CTCGCAACCAACAACGTGGTCGGCGGCACCGGGACGGGCAACGTGATCATCGCGCTCGGCCAGAGCGCGG
ACCAGGCCGCCAACCAGGCCGGGCAGTCGATCGTCTCGCGCGACCTCGGCGTTCAGCCGACCCTGACCGT
GCGCCCTGGCTTCCCGCTCGACGTGATGGTGAACCGCGACATCGTGCTGCGGCCCTATGGGAGAGGGTGA
 Primer design