SecReT4
Protein ID: 326404742
T4SS name [ID]Trb [343]
Gene symboltrbG
Locus tagACMV_25950
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]2856556..2857539 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDF0J2J8
KEGG IDamv:ACMV_25950
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-64, Aligned region: 98..321
Protein Sequence: 327 a.a.     [Download]
>gi|326404742|ref|YP_004284824.1| conjugal transfer protein TrbG [Acidiphilium multivorum AIU301]
MRFLLLLPVAGALALSACAQQVPKIAYDDPQPAHLIAPPPPPVRVVKLPEPLPLPGQLKKLPPATAYRQP
AQPANPVARVAAANEAARIDPTRDGYINAMQVFPWSTGALYEIYASPLHVTDIALQPGERLISIAAGDTV
QWKIGNTTSGSGPTTQVHVLVKPISADLPMNNIVIMTNRRAYHLEIHPTKQTYMAAVSWNYPQDDLLALK
AQNTAATDYASTVAASDVDLADLHFRYRISGDHSPWRPVQVFDDGSKVYIQFPPGIAQGDMPPLFILGAS
GGKAEIVNYRVRGNTMIVDRLFAGAELRLGAGPQQIVRITRTDGSSG
 
Nucleotide Sequence: 984 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2857539-2856556 Acidiphilium multivorum AIU301, complete genome
ATGAGATTTTTGCTCCTGCTCCCGGTCGCCGGCGCCTTGGCGCTCTCCGCCTGCGCGCAGCAAGTGCCAA
AAATCGCCTATGACGATCCGCAACCGGCCCATCTGATTGCACCGCCCCCGCCGCCCGTTCGGGTGGTGAA
GCTGCCGGAACCGCTGCCCTTGCCGGGTCAGTTGAAGAAACTCCCCCCGGCCACGGCGTATCGGCAACCA
GCGCAGCCAGCGAACCCGGTCGCGCGCGTGGCTGCAGCCAATGAAGCCGCTCGGATCGACCCGACGCGCG
ACGGCTACATCAACGCCATGCAGGTGTTCCCCTGGTCGACCGGCGCGCTCTATGAAATCTACGCCTCACC
GCTGCACGTCACCGATATCGCGCTGCAGCCCGGCGAGCGCCTGATCTCGATCGCCGCCGGCGATACCGTG
CAATGGAAGATCGGCAATACCACCAGCGGGTCCGGGCCGACCACGCAGGTCCATGTTCTAGTCAAGCCGA
TCTCGGCCGATCTGCCGATGAACAACATCGTCATCATGACCAATCGGCGCGCCTACCACCTCGAGATCCA
TCCCACGAAGCAGACCTACATGGCGGCGGTGTCCTGGAATTACCCGCAGGATGATCTGCTGGCACTCAAG
GCGCAGAACACCGCCGCCACCGATTACGCCAGCACCGTCGCGGCGAGTGACGTCGATCTTGCCGATTTAC
ATTTCCGGTACCGGATCAGCGGCGATCACTCGCCGTGGCGGCCCGTGCAGGTGTTCGATGACGGATCAAA
GGTCTACATCCAGTTCCCGCCCGGCATCGCCCAGGGCGACATGCCGCCGCTGTTCATCCTCGGCGCATCC
GGCGGCAAGGCAGAGATCGTCAACTATCGGGTGCGCGGTAATACGATGATCGTCGATCGGCTGTTCGCCG
GAGCAGAGCTCCGCCTCGGCGCCGGGCCGCAGCAGATCGTGCGGATCACTCGCACCGATGGCAGCAGCGG
ATGA
 Primer design