SecReT4
Protein ID: 326404744
T4SS name [ID]Trb [343]
Gene symboltrbL
Locus tagACMV_25970
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]2858243..2859592 [-]
Productputative conjugal transfer protein TrbL
Component typeTrbL
UniProt IDF0J2K0
KEGG IDamv:ACMV_25970
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.7e-37, Aligned region: 38..262
Protein Sequence: 449 a.a.     [Download]
>gi|326404744|ref|YP_004284826.1| putative conjugal transfer protein TrbL [Acidiphilium multivorum AIU301]
MGSNPSIIDHFLNVFSQYINSGFGLISPDVGFLVVVLIGIDATLAGLAWALGEDNVIQAFAKKVLYVGFF
AFILNNWQLLAEIVFNSFAGLGLKATGSSLTYAQFLHPGLLAQAGVQGADVLLSQIQRLAGFPNIFWNLG
EILVMGLSWIVTLLGFFVLAILLFLAIIEFKLTTLKGFILVPFALWRGTAFIAEPVLGQIVTSGVRVLVF
AVVTGIGTQLFSQILPSNPSAVLSLQDALTILLASMTIAGLAFSANRLAAGITSGAPQLGLGSTAAAGGA
AAGVVTLAGTGGIAAARAAASGVGAGTSLAGGASGAYAAGSVAGGGSVSAGLGGVARGAAGAAGSGLRGI
ALNATSGLRDRFAAGQRAGWAATGGSGSGAGGSGGGDSGGGAESASVPPGTTGTPARSGAPAWAENLRRR
QAYRTAEQIIREGEAGGGGMRPNLRGDRT
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2859592-2858243 Acidiphilium multivorum AIU301, complete genome
ATGGGTAGTAATCCGTCCATCATCGACCACTTTCTGAATGTTTTCAGTCAGTACATCAATTCTGGGTTTG
GGCTCATCTCGCCCGATGTCGGCTTCCTGGTCGTTGTTCTGATCGGTATCGATGCGACACTGGCTGGGCT
TGCCTGGGCTCTCGGCGAGGACAACGTCATCCAAGCCTTCGCTAAGAAAGTCCTGTATGTCGGCTTTTTT
GCATTCATCCTGAACAACTGGCAGCTTCTGGCAGAGATCGTCTTCAACAGCTTTGCCGGGCTCGGTCTGA
AGGCAACCGGATCGTCCCTTACCTATGCCCAATTCCTCCATCCCGGCCTGCTCGCCCAAGCCGGGGTGCA
AGGCGCCGATGTCCTGCTCTCGCAAATCCAGCGCCTCGCCGGGTTTCCGAACATCTTCTGGAACCTCGGC
GAGATCCTGGTCATGGGTCTGTCCTGGATCGTCACGCTGCTCGGCTTCTTCGTGCTGGCGATCCTGCTGT
TCCTGGCCATTATCGAATTCAAGCTCACGACCCTCAAAGGCTTCATCCTCGTTCCTTTCGCCCTCTGGCG
CGGCACCGCCTTCATCGCCGAGCCGGTGCTCGGCCAGATCGTCACCTCTGGGGTCCGTGTTCTGGTGTTT
GCCGTGGTGACCGGCATCGGCACCCAGTTGTTCAGTCAGATCCTGCCGAGCAACCCGTCGGCGGTACTGT
CGCTGCAGGACGCGCTCACCATCCTGCTGGCATCCATGACCATCGCCGGTCTCGCCTTCTCGGCGAACCG
CCTCGCGGCCGGTATCACCTCCGGCGCGCCGCAGCTTGGCCTTGGCAGTACTGCTGCAGCGGGCGGGGCC
GCTGCCGGTGTTGTCACATTGGCCGGGACGGGCGGGATCGCGGCGGCCCGCGCTGCGGCCTCCGGCGTCG
GTGCCGGAACCTCGCTCGCGGGCGGTGCCAGCGGTGCCTACGCCGCGGGCAGCGTCGCTGGTGGCGGCTC
CGTCTCGGCCGGCCTCGGCGGTGTCGCCCGTGGTGCCGCCGGTGCGGCTGGCAGCGGATTACGCGGCATC
GCCCTGAACGCTACGTCGGGATTGCGCGATCGCTTTGCCGCCGGCCAGCGCGCCGGTTGGGCGGCGACCG
GCGGCAGCGGCTCCGGTGCTGGTGGTTCGGGTGGTGGTGATTCGGGCGGCGGTGCAGAATCCGCATCGGT
GCCCCCAGGGACCACGGGGACTCCCGCTCGATCCGGCGCGCCAGCCTGGGCCGAAAATCTGCGGCGGCGT
CAAGCCTATCGGACGGCGGAGCAAATTATCCGCGAGGGCGAAGCCGGTGGCGGCGGGATGCGGCCCAATC
TGCGAGGAGACCGGACATGA
 Primer design