SecReT4
Protein ID: 326404749
T4SS name [ID]Trb [343]
Gene symboltrbC
Locus tagACMV_26020
StrainAcidiphilium multivorum AIU301
Repliconchromosome [GenBank: NC_015186] [Browse all T4SS(s) in this replicon]
Location [Strand]2863707..2864033 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDF0J2K5
KEGG IDamv:ACMV_26020
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1e-22, Aligned region: 12..98
Protein Sequence: 108 a.a.     [Download]
>gi|326404749|ref|YP_004284831.1| conjugal transfer protein TrbC [Acidiphilium multivorum AIU301]
MTTPVHPWQPNLIAILAGAMLWPASALAAGSNMPWEQPLQQILNSIEGPVAKIIAVLIIIGTGLGLAFGE
SSGGMRRLIQIVFGLSIAFAAASFFLTFFNFSGGALVG
 
Nucleotide Sequence: 327 bp     [Download]
>gi|326402148|ref|NC_015186.1|:c2864033-2863707 Acidiphilium multivorum AIU301, complete genome
TTGACGACCCCGGTCCATCCTTGGCAGCCGAACCTGATCGCCATTCTGGCCGGCGCGATGTTGTGGCCGG
CCTCCGCCCTGGCGGCTGGATCAAATATGCCGTGGGAGCAGCCGCTCCAACAAATCCTGAATTCGATCGA
GGGGCCGGTGGCAAAAATCATCGCCGTGCTGATCATTATCGGCACCGGCCTTGGTCTCGCCTTTGGCGAA
AGCTCCGGTGGCATGCGCCGTCTGATCCAGATCGTCTTCGGCCTGTCGATCGCCTTCGCCGCTGCGAGTT
TCTTCCTGACCTTCTTCAATTTCTCCGGCGGGGCGTTGGTCGGATGA
 Primer design