SecReT4
Protein ID: 32765047
T4SS name [ID]Tra_F [578]
Gene symboltrhI
Locus tagHCM1.107
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]82288..84072 [+]
ProductDNA helicase
Component typeTraI_F
UniProt IDQ9RGW0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam UvrD_C [PF13361], Evalue: 2.9e-39, Aligned region: 254..564
UvrD-helicase [PF00580], Evalue: 2.9e-28, Aligned region: 5..92
UvrD-helicase [PF00580], Evalue: 2.9e-28, Aligned region: 148..248
UvrD_C_2 [PF13538], Evalue: 3.2e-10, Aligned region: 496..562
AAA_19 [PF13245], Evalue: 4.9e-06, Aligned region: 13..85
Protein Sequence: 594 a.a.     [Download]
>gi|32765047|ref|NP_569320.2| DNA helicase [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MGKPTDEQRVIIENANANNMVIAAPGSGKSFTMIEAVISILRQFPYAKVGMVTFTRAATNSLAEKLKRRL
SKKDQDRVLVNTFHGFIRMQLDMVNWKGKMLISSAQRSVIHRALKESGAPFRYPDAEFAIDAIGREMDTD
IISVRHTRQQIHLFNTYQAICQKDHVADLNALSRFVVGQMYSGKMQPLNLTHLVVDEVQDTDSIQYAWIS
LHTRAGVNTSIVGDDDQAIYSFRASGGVKIFQQFEKQFRPNIFYLNTCFRCEPEILKVAGALIEKNVYRY
AKDLRSAKGGGGKVHFRSYVDMDEQIQGILNLINQDPIGWAILSRGNAHLDQLESLIEQPVLRYGGKSFW
DEKETSDVLHLMAFFRHSNDVRLMKRVLALFGENEEVLDQTALSMKGRKVTFGELNIPNESSLETRTLHS
NFTRFTQETREKVEIEKRFANLIKWMELSSIKMRTQKGSPSLSRIALDTCKQWAEKTGWQNMINRAAAMC
LGPKKKDEEYTPDKVVLSTLHGSKGLEWKNVIIMSCNADQIPSKRSVGQEAIEEERRLLFVGFTRAEQQL
HVMWYGDPSFFLSECAEDKLKEAAKSRTESPLTE
 
Nucleotide Sequence: 1785 bp     [Download]
>gi|18466424|ref|NC_003384.1|:82288-84072 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGGGTAAACCAACAGATGAGCAAAGGGTCATCATTGAAAATGCAAATGCTAATAATATGGTTATTGCAG
CACCGGGATCTGGAAAGTCATTCACGATGATAGAGGCGGTGATCTCTATCCTCAGGCAGTTCCCTTATGC
CAAAGTGGGGATGGTCACATTTACCCGTGCAGCAACAAATTCATTGGCTGAAAAACTGAAACGTCGATTA
AGTAAGAAAGACCAGGATAGGGTGCTGGTCAATACATTCCACGGCTTTATCCGGATGCAACTGGATATGG
TCAACTGGAAGGGCAAGATGTTGATTAGCTCGGCACAGCGTTCTGTAATTCACAGGGCATTGAAGGAGTC
CGGCGCGCCTTTTCGATACCCGGATGCAGAATTTGCTATTGACGCGATTGGAAGGGAAATGGATACGGAC
ATCATTTCAGTTCGCCATACGCGGCAACAAATCCACTTGTTCAACACCTATCAGGCAATATGTCAGAAAG
ACCACGTTGCAGATTTGAATGCACTCTCACGTTTTGTTGTGGGCCAGATGTACTCGGGGAAAATGCAGCC
ACTTAACTTGACACATTTAGTTGTAGATGAAGTTCAGGATACCGACTCGATTCAGTATGCCTGGATCTCA
CTACATACGAGGGCAGGTGTTAACACTAGCATCGTTGGGGATGATGATCAGGCAATTTATTCATTCAGGG
CATCAGGTGGAGTCAAAATATTCCAGCAGTTTGAAAAACAATTCAGGCCCAACATATTTTATTTGAATAC
TTGTTTCAGATGTGAACCAGAGATTTTGAAGGTAGCAGGGGCATTGATTGAAAAAAATGTTTACAGATAC
GCTAAAGATCTCCGTTCAGCTAAGGGCGGTGGGGGAAAAGTTCATTTCCGCTCATATGTTGATATGGATG
AGCAAATTCAAGGCATTCTCAATCTGATTAACCAAGACCCGATTGGGTGGGCAATCCTCAGCAGAGGTAA
TGCACATCTCGATCAGCTTGAAAGCCTGATAGAGCAGCCGGTACTTCGTTATGGTGGGAAGTCATTTTGG
GATGAAAAGGAGACAAGCGATGTATTGCATTTGATGGCATTCTTCCGACATTCCAACGATGTCCGGTTAA
TGAAGAGGGTGCTGGCGCTTTTCGGTGAAAATGAAGAGGTCTTGGACCAGACAGCATTGAGCATGAAAGG
AAGAAAAGTAACTTTTGGTGAACTGAACATCCCGAATGAAAGTTCCCTGGAAACAAGAACGCTTCATTCA
AACTTCACCCGGTTTACACAGGAGACTCGGGAAAAGGTTGAAATAGAAAAAAGGTTCGCAAATCTGATTA
AGTGGATGGAGTTGTCGTCGATAAAAATGAGGACGCAGAAAGGATCACCATCACTGAGCAGAATTGCGCT
GGATACCTGTAAGCAATGGGCCGAAAAGACAGGCTGGCAAAATATGATAAATCGAGCTGCGGCGATGTGT
CTGGGGCCAAAGAAGAAGGATGAGGAATATACACCGGATAAAGTAGTTTTATCGACGTTGCACGGTTCGA
AGGGTCTTGAATGGAAAAATGTAATTATTATGAGTTGTAATGCAGATCAGATTCCAAGTAAGCGGTCAGT
GGGGCAGGAGGCGATTGAAGAAGAAAGACGACTGCTTTTTGTTGGGTTTACACGAGCAGAGCAACAGCTG
CATGTAATGTGGTACGGTGATCCGTCTTTCTTTTTAAGCGAATGTGCTGAAGATAAATTGAAAGAGGCTG
CGAAAAGTAGAACAGAATCCCCTTTGACAGAATAA
 Primer design