SecReT4
Protein ID: 32765051
T4SS name [ID]Tra_F [578]
Gene symbol-
Locus tagHCM1.272
StrainSalmonella enterica subsp. enterica serovar Typhi str. CT18
Repliconplasmid pHCM1 [GenBank: NC_003384] [Browse all T4SS(s) in this replicon]
Location [Strand]205783..207765 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDQ935G9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.1e-16, Aligned region: 165..550
TrwB_AAD_bind [PF10412], Evalue: 8.8e-14, Aligned region: 399..606
TraG-D_C [PF12696], Evalue: 2.4e-09, Aligned region: 471..583
Protein Sequence: 660 a.a.     [Download]
>gi|32765051|ref|NP_569455.2| hypothetical protein HCM1.272 [Salmonella enterica subsp. enterica serovar Typhi str. CT18]
MLVMGFRSDGVNIAPIILYTAVFLLLVCLYRCKTAHPYLMAHWRVFQRQIMFISLKSLRTINKSNFFSNE
RKYRQLVQEYKKNNRPVPDRKTYFCNGFEWGPEHADRAYQIANLSSDKREIALPFVLSPIARHFETMARS
MGGNNAIFAVDRRAPIFVTEDNWFGHTLITGNVGTGKTVLQRLLSISMLHLGHVIVVIDPKNDAEWRQSL
MDEASELGLPFYKFHPAQPSSSVCIDVCNAYTNVSDLTSRLLSLVSVPGEVNPFVQYAEALISTVITGLS
YTDKKPSIYLIHKNMKSHMSVVNLTIKVMECCFARHYGPDVWMEKVKYASNDTLQVRFKRLTEWFNAHFL
NYEGAEPIEWIDTVGRLVDYSMSDPEHMSKMTAGIMPLFSRLTEQPLNELLSPSPNTLTSREIVTSDGMF
STGGVLYISLDGLSNPESARAISQLIMSDLTSCAGSRYNADDGDMSSHSRISIFVDEAHSAINNSMINLL
AQGRAAQIALFICTQTISDFIAAANAETANRITGLCNNYISLRVNDTPTQTLVVENFGKSPISTNMVTYT
TGSETTLPHNNFSGSISERKQTTLEESIPKELLGQVPKFHIVARLQDGRKVVGQIPIAVSEKAMKPNTTL
LEMFLKPAGKVTLRQNVGLSYLNKYLRKLH
 
Nucleotide Sequence: 1983 bp     [Download]
>gi|18466424|ref|NC_003384.1|:205783-207765 Salmonella enterica subsp. enterica serovar Typhi str. CT18 plasmid pHCM1, complete sequence
ATGCTGGTTATGGGCTTTCGTTCAGATGGGGTGAATATTGCCCCTATCATTCTTTATACCGCTGTTTTCC
TGCTTTTGGTTTGTTTGTACCGTTGTAAAACGGCACACCCCTATTTGATGGCACACTGGCGCGTATTTCA
GCGCCAGATAATGTTTATTAGCCTCAAGTCGCTCAGGACGATCAATAAAAGTAACTTTTTCTCGAACGAG
CGAAAGTATCGCCAGCTGGTACAAGAGTATAAAAAAAATAACCGACCAGTACCGGATAGAAAAACCTACT
TTTGTAACGGCTTTGAATGGGGTCCCGAGCATGCAGACCGCGCATATCAAATTGCTAATCTCTCAAGTGA
CAAAAGAGAGATAGCCCTGCCATTTGTTCTAAGCCCTATAGCGCGACATTTTGAAACAATGGCCAGATCC
ATGGGGGGCAATAACGCCATCTTTGCTGTTGACCGGCGGGCACCCATTTTTGTGACCGAAGATAACTGGT
TCGGACATACCCTCATTACCGGAAACGTCGGTACCGGTAAAACGGTACTTCAGCGCTTACTGAGCATCAG
CATGCTGCATTTGGGCCATGTCATTGTGGTTATTGACCCGAAGAATGACGCTGAGTGGCGACAGTCACTG
ATGGATGAAGCGTCAGAACTGGGGTTGCCATTTTATAAATTTCACCCAGCCCAGCCGTCTTCATCGGTGT
GTATTGATGTATGCAATGCTTACACAAATGTTTCGGACCTCACCTCACGACTTCTTAGTCTGGTTTCGGT
TCCCGGGGAAGTTAACCCATTCGTGCAATATGCCGAAGCTCTCATCTCAACGGTGATCACTGGTCTGTCT
TACACGGATAAAAAACCGTCGATATATCTCATCCACAAAAACATGAAAAGCCATATGTCTGTTGTGAACC
TAACGATAAAAGTAATGGAATGCTGCTTTGCACGACACTACGGGCCTGATGTCTGGATGGAAAAGGTGAA
ATACGCTTCGAATGACACTCTTCAGGTTCGATTTAAGCGCCTGACAGAATGGTTTAATGCCCATTTTCTT
AATTATGAAGGCGCCGAGCCCATTGAATGGATTGATACCGTCGGTCGGTTAGTGGATTACTCCATGTCTG
ATCCTGAACACATGTCTAAAATGACGGCGGGTATTATGCCGCTATTTAGTCGACTGACTGAACAACCACT
GAATGAATTGCTTTCGCCGTCTCCTAATACACTCACTTCGCGTGAAATAGTCACTTCAGATGGGATGTTC
AGTACCGGCGGAGTTCTGTATATCTCGCTCGATGGCCTTTCCAACCCGGAATCAGCCCGGGCCATTTCGC
AGTTGATAATGTCAGATCTTACGTCTTGTGCGGGTAGTCGTTATAACGCTGACGATGGTGATATGTCTTC
CCATTCAAGAATCAGTATTTTCGTCGACGAAGCACACTCTGCCATAAACAATTCAATGATAAACTTACTC
GCACAGGGTCGTGCCGCTCAAATTGCATTATTTATCTGCACGCAAACTATTTCCGACTTTATTGCAGCAG
CGAACGCTGAGACGGCAAACCGTATTACAGGTCTATGTAACAACTACATTAGCCTGCGGGTAAACGACAC
ACCAACACAAACGCTGGTCGTAGAAAACTTTGGTAAGAGTCCAATTAGTACAAATATGGTCACGTATACG
ACAGGATCTGAAACCACTTTGCCGCATAATAACTTCTCTGGGTCAATATCAGAAAGAAAGCAAACAACGC
TGGAAGAAAGTATTCCAAAAGAGCTTTTGGGCCAGGTCCCCAAATTCCATATTGTGGCCAGACTTCAGGA
TGGTCGTAAAGTTGTCGGGCAGATCCCGATTGCCGTAAGTGAAAAAGCGATGAAACCCAATACGACGTTA
CTGGAGATGTTCCTGAAACCCGCCGGAAAAGTAACTTTGCGCCAGAATGTGGGTTTAAGCTATTTAAATA
AATATCTAAGGAAATTGCATTGA
 Primer design