SecReT4
Protein ID: 328541604
T4SS name [ID]Trb [289]
Gene symbol-
Locus tagSL003B_p0036
StrainPolymorphum gilvum SL003B-26A1
Repliconplasmid pSL003B [GenBank: NC_015258] [Browse all T4SS(s) in this replicon]
Location [Strand]48587..49462 [-]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF2J742
KEGG IDpgv:SL003B_p0036
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.4e-59, Aligned region: 76..288
Protein Sequence: 291 a.a.     [Download]
>gi|328541604|ref|YP_004301714.1| P-type conjugative transfer protein TrbG [Polymorphum gilvum SL003B-26A1]
MKGMAPNMNIRLENFSAMLIAGATASTALAAIALAPLHAFAADGVTANEAKGVSISGQWRGSRGLVTKGA
DGKVIFLFGEVQPSVVCSPLQVCDIELQGGEVVRDVLVGDTVRWKVEPATSGAAGGQAIHLIVKPSEPGL
VTSMVVTTSRRTYHIQLKSHATQYMARVGFEYPEDVSAKLADINARLEASTIPGAGVPAEQLNFSYSVSG
RAGWRPTRVYSDGLKTYIQFPRSISGQDAPVLFVTSGGQNRIVNYRMKNDMMVVDYHIDRAVLVSGVGWK
QEKVTIRRGGR
 
Nucleotide Sequence: 876 bp     [Download]
>gi|328541554|ref|NC_015258.1|:c49462-48587 Polymorphum gilvum SL003B-26A1 plasmid pSL003B, complete sequence
TTGAAAGGCATGGCCCCGAACATGAATATCCGACTTGAGAATTTTTCGGCCATGTTGATTGCCGGCGCCA
CCGCATCGACGGCACTGGCGGCCATTGCCCTTGCCCCTCTCCACGCTTTTGCGGCCGATGGCGTCACCGC
CAATGAGGCGAAGGGCGTGAGCATCTCCGGCCAGTGGCGGGGATCGCGCGGGCTTGTGACCAAGGGAGCC
GACGGCAAGGTGATTTTTCTTTTTGGCGAGGTGCAGCCGTCGGTCGTCTGCTCGCCACTCCAAGTCTGCG
ACATCGAGCTTCAGGGAGGCGAGGTCGTTCGCGACGTCCTCGTTGGCGACACCGTGCGGTGGAAGGTCGA
GCCGGCGACATCAGGTGCGGCGGGCGGCCAGGCGATCCACCTGATCGTCAAGCCGTCGGAGCCTGGTCTC
GTCACCTCGATGGTGGTGACGACGTCGCGGCGGACCTATCATATCCAGCTCAAGTCGCATGCCACGCAAT
ACATGGCCCGCGTCGGTTTCGAATATCCGGAGGACGTCTCGGCGAAGCTCGCCGATATCAATGCCCGCCT
CGAGGCGAGCACCATTCCAGGCGCCGGCGTGCCGGCCGAGCAGTTGAACTTCTCCTATTCGGTCTCAGGC
AGGGCCGGCTGGCGGCCGACACGGGTCTATTCCGATGGCCTGAAAACCTACATCCAGTTCCCGCGCTCGA
TTTCCGGCCAGGATGCACCGGTGCTGTTCGTCACCTCCGGCGGACAGAACCGGATCGTCAACTACCGGAT
GAAGAACGACATGATGGTGGTCGATTATCACATCGATCGCGCGGTGCTCGTCTCCGGCGTCGGATGGAAA
CAGGAAAAGGTGACGATCAGAAGAGGAGGGCGGTGA
 Primer design