SecReT4
Protein ID: 328541606
T4SS name [ID]Trb [289]
Gene symbol-
Locus tagSL003B_p0038
StrainPolymorphum gilvum SL003B-26A1
Repliconplasmid pSL003B [GenBank: NC_015258] [Browse all T4SS(s) in this replicon]
Location [Strand]50151..51347 [-]
ProductConjugal transfer protein
Component typeTrbL
UniProt IDF2J744
KEGG IDpgv:SL003B_p0038
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.1e-30, Aligned region: 67..278
Protein Sequence: 398 a.a.     [Download]
>gi|328541606|ref|YP_004301716.1| Conjugal transfer protein [Polymorphum gilvum SL003B-26A1]
MVIVRPSRKLELSFISIGLILLVATPALAQQGSVLTTLENSVVTAAKGWETTVMNAARSLFWILAGIEVG
IAAVWLAINAASLDSWFAELVRRIMFIGLFAFILDQGPSFAKAVVDSLYQIGAGGGSASPANIFDAGIRV
ATKMSEQAKFGLWEDNALAIAAVFAMVVVVVSFSLVAAIFVAVMVEMYVGLLAGMIMLGLGGSSFTKDFA
VKYLVYAFSVGMKLMALVMIAKIGSDILLGLAEAPTATSEQFITTLAIAGISVVVFVIAMYVPPILQGVV
QGASIAGGMEAIRHGGQAATFAAGGAFLGASAATKGAQTASSARAGGSSLAGAALRGMASGIGSAGWAAG
SAAKEKAIASPGAYAGSLLGLANAKLDQTRQSGRPTPPPPPPPINENK
 
Nucleotide Sequence: 1197 bp     [Download]
>gi|328541554|ref|NC_015258.1|:c51347-50151 Polymorphum gilvum SL003B-26A1 plasmid pSL003B, complete sequence
ATGGTGATCGTCCGTCCCTCCCGGAAGCTGGAGCTTTCGTTCATTTCGATCGGCCTCATCCTGTTGGTCG
CGACACCGGCGCTTGCCCAACAGGGTTCGGTTCTAACCACACTGGAAAACTCCGTCGTCACAGCCGCGAA
AGGCTGGGAGACGACGGTGATGAACGCGGCGCGGTCGCTGTTCTGGATCCTTGCCGGCATCGAGGTCGGG
ATCGCCGCGGTGTGGCTGGCGATCAACGCCGCCTCGCTCGACAGCTGGTTCGCCGAACTCGTCCGGCGGA
TCATGTTCATCGGTCTCTTCGCCTTCATCCTCGACCAGGGCCCGTCCTTCGCCAAGGCCGTGGTCGACAG
CCTCTATCAGATCGGTGCCGGCGGCGGCTCGGCTTCACCCGCAAATATCTTCGACGCCGGCATTCGGGTC
GCGACCAAAATGTCCGAGCAGGCGAAGTTCGGGCTTTGGGAAGACAATGCGCTGGCGATCGCCGCCGTCT
TCGCCATGGTCGTGGTCGTCGTCTCCTTCTCGTTGGTTGCCGCGATTTTCGTCGCCGTCATGGTCGAGAT
GTATGTCGGTCTGCTCGCCGGCATGATCATGCTCGGTCTTGGCGGCTCGTCCTTCACCAAGGATTTCGCG
GTCAAATATCTGGTCTACGCCTTCTCCGTCGGCATGAAGCTGATGGCGCTGGTGATGATCGCCAAGATTG
GCTCCGACATCCTGCTCGGCTTGGCGGAAGCGCCGACAGCGACCTCCGAGCAGTTCATCACCACACTTGC
CATCGCCGGCATCTCGGTGGTGGTCTTCGTGATCGCCATGTATGTCCCGCCGATTCTGCAGGGTGTGGTC
CAGGGCGCGTCGATTGCCGGAGGTATGGAAGCGATCCGTCATGGCGGCCAGGCCGCGACATTCGCGGCCG
GCGGCGCTTTCCTTGGCGCGAGTGCCGCAACGAAAGGAGCGCAGACGGCTAGCTCGGCGAGGGCAGGGGG
CTCTTCGTTGGCTGGAGCGGCGCTGCGCGGCATGGCGTCCGGTATTGGAAGTGCTGGATGGGCTGCCGGA
TCCGCAGCCAAGGAGAAGGCGATCGCGTCTCCCGGCGCCTATGCCGGATCGCTGCTCGGGCTTGCCAACG
CCAAGCTCGACCAGACGCGTCAGTCGGGCCGACCAACACCGCCACCTCCACCCCCACCCATCAACGAGAA
CAAGTAG
 Primer design