SecReT4
Protein ID: 328541611
T4SS name [ID]Trb [289]
Gene symbol-
Locus tagSL003B_p0043
StrainPolymorphum gilvum SL003B-26A1
Repliconplasmid pSL003B [GenBank: NC_015258] [Browse all T4SS(s) in this replicon]
Location [Strand]55119..55523 [-]
ProductConjugal transfer protein
Component typeTrbC
UniProt IDF2J749
KEGG IDpgv:SL003B_p0043
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.1e-22, Aligned region: 4..100
Protein Sequence: 134 a.a.     [Download]
>gi|328541611|ref|YP_004301721.1| Conjugal transfer protein [Polymorphum gilvum SL003B-26A1]
MLHKTKITLACLGLAAIALALAEPALASSGGGGLPWESPLQQIQQSITGPVAGFIALAAVAIAGAMLIFG
GELNDFARRLCYVALVGGVLLGATQIVALFGATGASIGEVEVRSAPHITEPTEVLRTEGEGAHG
 
Nucleotide Sequence: 405 bp     [Download]
>gi|328541554|ref|NC_015258.1|:c55523-55119 Polymorphum gilvum SL003B-26A1 plasmid pSL003B, complete sequence
ATGTTGCATAAGACAAAGATCACGCTCGCCTGCTTGGGCCTCGCCGCTATCGCTCTCGCCCTGGCGGAAC
CGGCACTGGCTTCCTCGGGTGGTGGCGGCCTTCCATGGGAGTCGCCGCTGCAGCAGATTCAGCAGTCCAT
CACCGGGCCTGTTGCCGGCTTCATCGCTCTGGCAGCTGTGGCAATCGCCGGCGCCATGCTCATCTTCGGC
GGCGAGCTCAATGATTTCGCGCGGAGGCTTTGCTACGTCGCCCTCGTCGGCGGCGTTCTGCTGGGCGCAA
CTCAAATCGTCGCCCTGTTCGGCGCAACCGGCGCCAGCATCGGCGAGGTCGAAGTGCGATCGGCACCTCA
CATCACCGAGCCGACGGAAGTGCTTCGCACGGAAGGGGAGGGGGCTCATGGCTGA
 Primer design