SecReT4
Protein ID: 330399509
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00673
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]48695..50719 [+]
Productconjugal transfer protein TrbL
Component typeTraD_F
UniProt IDE5AVY3
KEGG IDbrh:RBRH_00673
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.4e-145, Aligned region: 171..552
TraG-D_C [PF12696], Evalue: 4.1e-22, Aligned region: 411..533
T4SS-DNA_transf [PF02534], Evalue: 1.6e-14, Aligned region: 359..547
AAA_10 [PF12846], Evalue: 2.9e-13, Aligned region: 184..490
Protein Sequence: 674 a.a.     [Download]
>gi|330399509|ref|YP_004030607.1| conjugal transfer protein TrbL [Burkholderia rhizoxinica HKI 454]
MVKRDAKRSASSFSRGAELWMHQARMFVVAIWTVALVSMIVALAVAVGYFWTATPPNERYGLERNILAHI
RDALYMTAGKMELHVNGELRKLEVADVALLTDEIADNAWRKLRNGGVIGLLSGIGMIFLISLYWWGYGRS
KMQDVKLRGAELVTGRELKKIVELRNEASPYMLAGVPMRKGSENLHTLIAGTQGTGKSQQFFALMKQVRA
RGKRMIVYDPTGEFTQAFYREGKDVLMNPLDARSPNWNVWHEIKKDYHFDNLANGLIPDPAEVDPFWSLA
GRMVLKDVYRVLGREGRRTNRDLYNAIAKSNLDAMHALLQGTAGATYVDPKTERTGMSLKMTVQNQLESF
RFLHDSGEPFSIRNWVHEEGDSWMFITARESMREALAPLLSLWIDTAIKAVLDLEAVHRERLWFCIDELP
TLQKLDILKLALTNTRKYGLCMVLGVQDFSQLYKIYGMHLASTIISGCQTKLLLRVTDGEAAELLAKLMG
QYEVDEKEETLSYGLNSHRDGVSVFARRNIRDLVLTSEILKLPDMTGYLTIPGDFPIAKVSYDYVPTPKI
ASGFIERTGLAVDFKPKYALSAVANTSAEDPADKQPGTEQAAKADAEKRPAVDLLDEDDVDGPTATVTGV
KRNANGETIDPETGKARPRSHVKDDAAATDKPGGKHGKPLADAL
 
Nucleotide Sequence: 2025 bp     [Download]
>gi|330399456|ref|NC_014723.1|:48695-50719 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGGTCAAACGTGACGCGAAGCGCAGCGCGAGTAGCTTTTCGCGCGGCGCAGAACTATGGATGCATCAGG
CCAGAATGTTTGTTGTGGCGATCTGGACCGTTGCGCTCGTTTCCATGATCGTTGCTCTAGCCGTGGCGGT
GGGCTACTTCTGGACCGCCACCCCTCCTAATGAGCGGTACGGGTTGGAGCGCAATATCCTAGCCCACATC
CGTGACGCCTTGTACATGACGGCGGGGAAGATGGAGCTGCACGTCAACGGCGAATTGCGCAAGCTGGAAG
TCGCGGACGTGGCGCTCTTGACCGACGAGATAGCTGACAACGCATGGCGCAAGCTGCGCAACGGTGGAGT
GATCGGCTTGCTGTCCGGCATTGGCATGATCTTTCTTATCAGTTTGTACTGGTGGGGATACGGGCGCTCA
AAGATGCAGGATGTGAAGCTTCGCGGTGCCGAGCTGGTGACGGGCCGGGAACTGAAAAAAATTGTTGAAT
TGCGTAACGAGGCTAGCCCGTACATGCTAGCTGGCGTGCCGATGCGCAAGGGCTCAGAAAATCTGCATAC
GCTGATTGCGGGCACGCAGGGTACGGGTAAGTCACAGCAGTTTTTTGCGCTGATGAAACAGGTCCGCGCG
CGCGGGAAGCGCATGATTGTGTATGATCCAACCGGTGAATTCACCCAGGCGTTTTATCGGGAGGGCAAGG
ATGTACTGATGAACCCGCTCGATGCGAGGAGCCCGAACTGGAACGTTTGGCACGAAATCAAGAAAGACTA
CCATTTCGATAATCTAGCGAACGGCCTGATTCCCGATCCGGCCGAAGTAGACCCATTTTGGTCCCTGGCG
GGCCGGATGGTGCTAAAGGATGTGTATCGCGTCTTGGGCAGAGAGGGCCGGCGCACGAACCGCGATCTGT
ACAACGCCATCGCCAAGAGCAACTTAGATGCGATGCATGCGCTGCTGCAAGGCACTGCCGGTGCCACCTA
CGTTGATCCGAAGACCGAGCGCACCGGCATGTCGCTCAAGATGACCGTGCAGAATCAGCTCGAGTCTTTT
CGCTTCTTGCACGATAGCGGCGAGCCGTTCTCCATCCGTAATTGGGTGCATGAGGAGGGTGATTCATGGA
TGTTTATCACGGCACGTGAGTCGATGCGCGAAGCGCTGGCACCGCTGCTATCGCTGTGGATCGACACGGC
AATCAAGGCGGTACTTGACCTCGAAGCGGTGCATCGTGAACGGCTTTGGTTCTGCATTGACGAGTTGCCG
ACTCTACAAAAGCTTGACATCCTCAAGCTCGCGCTCACCAACACCCGCAAGTACGGGCTGTGCATGGTGC
TCGGCGTTCAAGACTTCTCTCAACTCTACAAAATCTATGGCATGCACCTGGCCAGTACAATCATTTCCGG
CTGTCAAACCAAGCTGCTGCTGCGTGTGACAGACGGCGAGGCGGCCGAGCTACTGGCAAAATTGATGGGG
CAATACGAGGTAGACGAGAAGGAAGAAACTCTGAGCTATGGCCTGAATTCGCATCGTGACGGCGTAAGCG
TTTTCGCGCGCCGGAACATCCGCGACCTCGTGCTTACCTCGGAAATCCTAAAACTACCCGATATGACCGG
CTACTTGACCATTCCCGGCGATTTTCCGATTGCTAAGGTGAGCTACGACTACGTGCCAACGCCAAAAATC
GCCAGTGGCTTTATTGAGCGTACGGGGCTAGCCGTCGACTTCAAGCCGAAATATGCGCTATCCGCCGTGG
CTAATACATCGGCTGAAGATCCAGCAGATAAACAACCGGGTACTGAGCAGGCAGCGAAGGCCGATGCCGA
GAAAAGGCCGGCCGTCGATCTGCTGGACGAGGACGATGTGGATGGTCCGACTGCCACAGTGACGGGGGTG
AAGCGCAACGCCAACGGCGAAACCATTGACCCGGAAACGGGCAAAGCGCGCCCGCGTTCGCATGTGAAAG
ACGATGCCGCGGCAACCGATAAACCGGGCGGAAAGCACGGAAAACCGCTTGCCGACGCCTTGTAA
 Primer design