SecReT4
Protein ID: 330399510
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00671
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]50794..52944 [+]
ProductDNA helicase I TraI
Component typeTraI_F
UniProt IDE5AVY4
KEGG IDbrh:RBRH_00671
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 5.6e-90, Aligned region: 58..347
AAA_30 [PF13604], Evalue: 7.7e-49, Aligned region: 478..659
PIF1 [PF05970], Evalue: 3.2e-08, Aligned region: 484..601
AAA_19 [PF13245], Evalue: 6.3e-06, Aligned region: 486..548
DUF2075 [PF09848], Evalue: 2.1e-05, Aligned region: 497..599
Viral_helicase1 [PF01443], Evalue: 7e-05, Aligned region: 499..627
Protein Sequence: 716 a.a.     [Download]
>gi|330399510|ref|YP_004030608.1| DNA helicase I TraI [Burkholderia rhizoxinica HKI 454]
MTERWRNSGVLCRAPTCRSDRLNVARMRSWMDVRFAFLASFQRSGTERGQGMISMHNVGSAGQALHYFSK
DNYYTQGEGLEYSEWFGKGAAQLDLFEQIDRQAFFNILSGEVEGRELGKWVKNGETGEKEREHRPGTDVT
FSAPKSVSLLAEVHGNCQVREAHEAAVKQALSYVESNLAQTRQTEGGKTEVVQTGNLTVAMFRHNTSRNL
DPQTHTHAVIVNATRRDDGQWRSLTNDDIYKAQRVVGAIYTSELADRLQALGYDLRRTDEKGNFEIAGIT
REQIEHFSQRRAEIEASLKAKGVDIDDATAQQKEDATLKTRARKVDVDHAQLIADWKDRAKEIGIDFDAI
QAKADAQRAQGGVVREDKLTGRQAMEFAAAHLIEREIVVTKYDLMAVAIEHGVGRVCVSEVQLAFDRLEC
DGDLVKLPDGQYTTKKMLGSEMWTLDQVRAHTGQVPKMIDSAAVAARIQLAEKRQGFQYTAGQKEAICKV
LTSEDRYVAVQGLAGTGKTTMLKSLREMAKEQGYTVRGMAPTGMASKVLARETGIATDTVSMFQIKERQL
QKDIEFAKQYAPDFERKTEVWIVDESSLLSQRQKARLDYMAEKAGAKVLYLGDTLQLQGVEAGKPFELAQ
RNGMDTAYMTEISRQKTRELQRAVDIIVGRDVLQDGQQLTQVELANNRRAFAYMDKAGMVREVKGGSGAV
IDAVVQDVLQMGKAER
 
Nucleotide Sequence: 2151 bp     [Download]
>gi|330399456|ref|NC_014723.1|:50794-52944 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGACCGAGCGCTGGCGAAATAGTGGCGTACTATGTCGGGCGCCAACGTGCCGATCTGACAGACTAAACG
TGGCAAGGATGCGCAGTTGGATGGACGTGCGATTTGCCTTTCTTGCGAGCTTTCAGCGTTCTGGCACCGA
AAGGGGGCAGGGGATGATAAGTATGCACAATGTGGGCAGCGCTGGGCAAGCGTTGCACTACTTCTCCAAA
GACAATTACTACACTCAGGGCGAAGGGTTGGAGTACTCTGAGTGGTTTGGCAAGGGGGCAGCGCAGCTTG
ACCTGTTTGAGCAGATCGACCGGCAAGCGTTTTTTAACATCCTTTCTGGAGAAGTTGAGGGTCGTGAACT
GGGCAAGTGGGTAAAAAACGGGGAAACTGGCGAGAAGGAGCGCGAGCACCGGCCAGGCACTGACGTGACA
TTCTCCGCACCCAAAAGCGTGTCTTTGCTGGCCGAGGTGCATGGCAATTGTCAGGTGCGCGAGGCGCACG
AAGCGGCCGTCAAGCAGGCGCTTAGTTACGTAGAGTCGAACCTCGCGCAGACGCGGCAGACCGAGGGCGG
TAAGACGGAGGTGGTGCAGACAGGCAATCTAACAGTGGCTATGTTCCGCCACAACACAAGCCGCAATCTG
GACCCTCAAACCCACACACATGCCGTCATTGTGAACGCCACCCGCCGCGATGACGGGCAATGGCGCTCGC
TAACCAACGACGACATTTATAAAGCGCAGCGCGTGGTCGGTGCAATCTACACGTCGGAGTTGGCCGATCG
CCTGCAGGCGCTGGGCTACGATCTGCGGCGCACGGACGAGAAAGGCAACTTTGAGATTGCCGGCATTACC
AGAGAGCAGATCGAGCACTTTAGTCAGCGCCGGGCGGAAATTGAGGCCTCTCTAAAAGCCAAGGGCGTGG
ACATTGACGATGCGACGGCTCAGCAAAAGGAGGACGCTACCCTAAAAACGCGGGCCCGTAAGGTGGACGT
GGACCATGCCCAACTCATTGCTGACTGGAAGGATCGAGCCAAGGAGATCGGCATCGACTTCGATGCTATC
CAGGCCAAGGCTGACGCCCAGCGTGCCCAGGGCGGCGTTGTGCGAGAAGACAAACTGACTGGCCGACAGG
CAATGGAGTTTGCTGCGGCCCACCTGATCGAACGTGAAATCGTGGTGACCAAATATGACCTCATGGCGGT
CGCCATCGAACACGGTGTTGGCCGTGTCTGCGTATCCGAGGTGCAACTGGCCTTCGATAGGCTAGAGTGC
GACGGCGACTTGGTGAAGCTGCCAGACGGACAGTACACCACTAAGAAGATGTTGGGCAGCGAAATGTGGA
CGCTGGACCAGGTGCGGGCTCACACGGGCCAAGTGCCGAAAATGATTGACTCGGCGGCCGTAGCCGCCCG
AATCCAATTGGCAGAGAAGAGACAGGGTTTTCAGTATACAGCCGGGCAAAAAGAGGCTATTTGCAAGGTG
CTGACCAGCGAGGACCGCTATGTGGCGGTGCAAGGCTTGGCTGGCACCGGCAAAACCACAATGCTCAAAT
CACTGCGGGAAATGGCCAAGGAGCAGGGCTACACCGTTCGAGGCATGGCGCCGACCGGGATGGCTAGCAA
GGTACTGGCTCGCGAAACCGGCATTGCTACTGATACTGTTTCGATGTTCCAGATTAAGGAGCGTCAGCTG
CAGAAGGACATTGAGTTCGCCAAGCAGTACGCGCCCGACTTCGAGCGCAAGACCGAGGTCTGGATTGTGG
ACGAGTCATCACTGCTGTCGCAGCGTCAGAAGGCCCGACTTGACTACATGGCCGAGAAGGCTGGTGCCAA
GGTCTTGTACCTGGGCGACACGCTGCAACTGCAGGGTGTGGAGGCCGGCAAGCCGTTCGAGTTGGCCCAA
CGTAATGGCATGGACACAGCCTACATGACCGAAATTAGCCGCCAGAAGACACGCGAGTTGCAGCGAGCTG
TGGATATTATTGTTGGTCGTGATGTTTTGCAGGACGGGCAGCAGCTGACTCAGGTAGAGCTGGCCAACAA
CCGCAGGGCATTTGCCTACATGGATAAGGCGGGCATGGTTCGCGAGGTTAAGGGGGGATCCGGAGCAGTG
ATTGATGCTGTGGTGCAAGATGTGCTCCAGATGGGGAAGGCGGAGCGTTGA
 Primer design