SecReT4
Protein ID: 330399511
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00669
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]52941..53813 [+]
ProductDNA helicase I TraI
Component typeTraI_F
UniProt IDE5AVY5
KEGG IDbrh:RBRH_00669
PDB IDNA
Domain hit(s) vs Pfam UvrD_C_2 [PF13538], Evalue: 7.6e-07, Aligned region: 130..239
Protein Sequence: 290 a.a.     [Download]
>gi|330399511|ref|YP_004030609.1| DNA helicase I TraI [Burkholderia rhizoxinica HKI 454]
MSAPSSSPAYNKDRVAINNGVREGLKAIGELDRNDDTREILVSKGWTRAMQREAQYYSQGDVVRFGRDYQ
QIDARKGEYMRVTSVDAPVGTVVLQKEDGSTIAWQPKKHNKIEVYETDRRGLARGDLIRLTRNEGEFKNG
EVARVVAIAGDRATLMLRQGKQVSLHEVDLSRNKHWDHAYASTVHGSQGATQYRAIFHIRAPETDNERKQ
QRLMERMAKVFGDRSFYVGTTRASHELRIYTNDKGLAARALAAKQDKTSAVEVIQRYEKGTGITAGRGSV
SPQLNRDYQR
 
Nucleotide Sequence: 873 bp     [Download]
>gi|330399456|ref|NC_014723.1|:52941-53813 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
TTGAGCGCACCATCGTCATCACCCGCGTACAACAAAGACCGCGTAGCGATCAATAACGGGGTGCGCGAGG
GCCTGAAGGCGATCGGTGAGCTGGACCGCAACGACGATACGCGAGAGATTCTGGTGTCAAAGGGCTGGAC
GCGTGCGATGCAAAGGGAGGCCCAATACTACAGCCAGGGCGACGTGGTGCGGTTCGGCCGCGACTACCAG
CAGATCGACGCCCGCAAGGGTGAGTACATGCGCGTGACGTCTGTTGATGCGCCGGTCGGGACGGTTGTGT
TGCAGAAGGAGGATGGTTCGACCATCGCTTGGCAGCCTAAGAAGCACAATAAGATTGAAGTCTACGAGAC
TGACAGGCGTGGCTTGGCCAGGGGCGATCTGATCCGCCTGACTCGAAACGAAGGCGAGTTCAAAAACGGC
GAGGTAGCCAGGGTAGTAGCCATTGCCGGCGACCGCGCAACCCTGATGTTGCGCCAGGGCAAACAGGTGT
CACTGCATGAGGTTGACCTTTCCAGGAACAAACATTGGGACCATGCTTACGCATCAACGGTCCACGGATC
CCAGGGCGCCACTCAGTATCGGGCAATCTTCCATATTCGGGCACCTGAAACGGATAATGAGCGCAAGCAA
CAACGCCTCATGGAGCGCATGGCAAAGGTGTTTGGTGACCGCAGCTTTTACGTCGGTACGACCCGTGCGA
GCCATGAGCTTCGCATCTACACCAACGACAAGGGCCTTGCAGCACGCGCCTTGGCCGCCAAGCAGGATAA
GACAAGTGCTGTGGAAGTCATCCAGCGGTACGAAAAAGGCACCGGCATTACGGCCGGCAGAGGCTCGGTG
TCGCCACAATTAAACCGTGACTATCAAAGGTAA
 Primer design