SecReT4
Protein ID: 330399514
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00666
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]56347..56844 [+]
Productinvasion protein IagB
Component typeOrf169_F
UniProt IDE5AVY8
KEGG IDbrh:RBRH_00666
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 165 a.a.     [Download]
>gi|330399514|ref|YP_004030612.1| invasion protein IagB [Burkholderia rhizoxinica HKI 454]
MNFVARTLAVASLLLVPIAASATCWEDAGRGYGIDPLLLKAIAWKESRGWAGAVGPKLADGNRAVGLMQV
NTIHLPTLIRFGIRREHLFDACVSQKVGAWVLADCIQRFGATWKAVGCYYVGPNSQNVAAQVRYVRDVQQ
FYEGYRRQAQQYSTTPAQVASYQGD
 
Nucleotide Sequence: 498 bp     [Download]
>gi|330399456|ref|NC_014723.1|:56347-56844 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGAATTTCGTTGCACGTACTTTAGCCGTTGCTAGCCTACTGTTGGTACCAATCGCTGCGTCTGCAACGT
GCTGGGAAGATGCGGGGCGGGGGTATGGTATCGACCCCTTGTTGCTCAAGGCGATCGCCTGGAAAGAGTC
GCGCGGCTGGGCCGGCGCGGTCGGTCCTAAGCTGGCGGACGGCAACCGCGCCGTGGGCCTCATGCAGGTC
AATACAATTCATTTGCCGACCCTGATACGGTTCGGCATCCGTCGCGAGCATCTGTTCGACGCTTGCGTGA
GCCAGAAGGTGGGCGCATGGGTGCTAGCCGACTGCATCCAGCGCTTTGGCGCCACCTGGAAAGCAGTGGG
TTGCTATTACGTTGGCCCCAACTCTCAGAATGTCGCTGCCCAAGTCAGATACGTACGGGACGTACAGCAA
TTCTACGAAGGCTACAGGCGGCAGGCACAGCAATACTCAACCACGCCGGCACAAGTTGCTAGCTACCAAG
GGGATTGA
 Primer design