SecReT4
Protein ID: 330399517
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00663
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]57645..57944 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDE5AVZ1
KEGG IDbrh:RBRH_00663
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 4.5e-15, Aligned region: 12..97
Protein Sequence: 99 a.a.     [Download]
>gi|330399517|ref|YP_004030615.1| hypothetical protein RBRH_00663 [Burkholderia rhizoxinica HKI 454]
MAMSERTDLSHYIPRRLDDAPKFLFWELDIAGIGLMGVLAGIATGFPILGLGLGVATAFFYSKLKTGKHP
GIATHLLYWFTGFPQPKELPGSHIRELNG
 
Nucleotide Sequence: 300 bp     [Download]
>gi|330399456|ref|NC_014723.1|:57645-57944 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
GTGGCTATGTCAGAAAGAACCGATCTTTCCCACTACATCCCGAGGCGTTTGGACGATGCCCCCAAGTTCC
TATTCTGGGAGTTGGACATTGCTGGCATTGGCTTAATGGGTGTCTTGGCAGGCATTGCCACGGGCTTTCC
CATTCTTGGTCTGGGTCTTGGAGTTGCAACTGCGTTTTTCTACAGCAAGCTTAAGACAGGCAAGCACCCG
GGCATAGCCACCCACCTCTTGTACTGGTTCACCGGGTTCCCGCAGCCCAAGGAGCTGCCGGGTAGCCATA
TCCGAGAACTCAACGGATAG
 Primer design