SecReT4
Protein ID: 330399518
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00662
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]57958..58545 [+]
Producthypothetical protein
Component typeTraE_F
UniProt IDE5AVZ2
KEGG IDbrh:RBRH_00662
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.1e-32, Aligned region: 5..186
Protein Sequence: 195 a.a.     [Download]
>gi|330399518|ref|YP_004030616.1| hypothetical protein RBRH_00662 [Burkholderia rhizoxinica HKI 454]
MSPEKANNERDWLKSQVRFHRALNVGLLAALLMGVILLGFVVLRDTTKIVPPEVKRPYEISSNYANKDYL
LDMADYVLAQVLTVTPDNVDYNVKTILRMAHPDGYGALKASLEAAALRMRHERVTTIWVPRKEEVNEQDL
RVKVSGRLKTYIADKLTSERDKDYLVEFNVTVSGRLYVSKIEEIVKRDPSKPTGT
 
Nucleotide Sequence: 588 bp     [Download]
>gi|330399456|ref|NC_014723.1|:57958-58545 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGTCGCCAGAAAAAGCCAACAACGAGCGAGATTGGCTGAAATCGCAAGTGCGTTTTCATCGTGCGTTGA
ACGTCGGCTTGCTTGCCGCCCTGTTGATGGGAGTGATCTTGCTGGGTTTCGTCGTTTTGCGCGATACCAC
CAAGATCGTGCCACCTGAGGTGAAGCGCCCTTACGAAATCAGCTCGAACTACGCCAACAAGGACTACCTG
CTGGACATGGCCGACTATGTGCTGGCCCAGGTGCTGACCGTCACGCCAGACAACGTTGACTACAACGTCA
AGACCATCCTGCGCATGGCTCACCCGGATGGCTACGGTGCGCTCAAAGCGTCGCTGGAGGCCGCGGCGCT
TCGCATGAGGCATGAGCGGGTCACCACGATTTGGGTGCCGCGCAAAGAGGAGGTGAACGAGCAGGATCTG
CGCGTCAAGGTCAGCGGCAGGTTGAAGACCTACATCGCCGACAAGCTTACTTCCGAGCGTGACAAAGATT
ACCTTGTTGAATTTAACGTAACGGTCTCGGGGCGTCTGTATGTATCCAAAATTGAAGAAATCGTTAAGCG
CGATCCTTCTAAGCCTACTGGTACTTGA
 Primer design