SecReT4
Protein ID: 330399519
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00661
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]58487..59218 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDE5AVZ3
KEGG IDbrh:RBRH_00661
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 2.8e-48, Aligned region: 6..235
Protein Sequence: 243 a.a.     [Download]
>gi|330399519|ref|YP_004030617.1| hypothetical protein RBRH_00661 [Burkholderia rhizoxinica HKI 454]
MYPKLKKSLSAILLSLLVLEARATQIVDNADRGHVQVNISAHEQNRLAIEGRRIANVVPSAKGVLTYEKD
EALGALYFALASDSMNHGTVTLFVSDEKGMTYKLILVPRPVAGEEIILRPPSEKVALSSRAASGNRALSY
QRHIKDLMLVMADESQQASVDVITVNKEVPLWKEGHLVLEDKYIDDDMVGEKYRLTNVSPSDMLLVEQEL
YRRGVRAVAIEHQTLPPGESTNIFIVRERKDND
 
Nucleotide Sequence: 732 bp     [Download]
>gi|330399456|ref|NC_014723.1|:58487-59218 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGTATCCAAAATTGAAGAAATCGTTAAGCGCGATCCTTCTAAGCCTACTGGTACTTGAAGCACGTGCAA
CGCAGATCGTTGACAACGCCGACCGAGGCCACGTTCAGGTCAATATCTCGGCCCACGAACAGAACCGCCT
GGCCATCGAGGGACGCCGCATTGCTAACGTCGTGCCTTCGGCCAAGGGCGTGCTGACGTACGAGAAAGAC
GAAGCGCTTGGTGCACTATATTTCGCCCTGGCCAGCGACAGCATGAACCACGGCACTGTCACGCTGTTCG
TCTCCGACGAAAAGGGCATGACCTACAAGCTGATTCTGGTGCCACGCCCGGTCGCCGGAGAGGAAATCAT
TCTGCGGCCGCCGAGCGAGAAGGTGGCCCTTTCGAGCCGTGCGGCATCGGGCAACCGCGCGTTATCGTAC
CAACGCCACATCAAAGACCTGATGCTGGTGATGGCTGATGAGTCGCAGCAGGCGAGCGTGGATGTCATCA
CGGTGAACAAGGAGGTGCCGCTGTGGAAGGAAGGCCACCTGGTTTTGGAGGACAAGTACATTGACGATGA
CATGGTGGGTGAGAAATACCGCCTAACCAACGTGTCCCCTTCCGACATGCTGTTGGTCGAACAGGAGTTG
TACCGGCGTGGCGTGCGCGCAGTCGCCATCGAGCATCAGACGTTGCCACCGGGGGAATCGACAAACATCT
TCATTGTGCGAGAGCGCAAAGACAATGATTGA
 Primer design