SecReT4
Protein ID: 330399520
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00660
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]59124..60551 [+]
Productconjugal transfer protein TraB
Component typeTraB_F
UniProt IDE5AVZ4
KEGG IDbrh:RBRH_00660
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.9e-39, Aligned region: 249..446
Protein Sequence: 475 a.a.     [Download]
>gi|330399520|ref|YP_004030618.1| conjugal transfer protein TraB [Burkholderia rhizoxinica HKI 454]
MACAQSPSSIRRCHRGNRQTSSLCESAKTMIDPNSQIKKRQMLLTGSAVAGIIVLIGAGMFLFDSGPTHH
REKPKTVSITAPGTVDDKDAWRAQQAAAEKANSTRIDEVKAQLTAQEEANKRLAQALEELKAGKAADAGA
SSLAADVSVLDKPLPTRHTGAGQRVLNSPTGNSESGILNQPLNSAPEPPKRELEMITFGLPGGKVGMDGL
RAGAADGNAEGGGFRSNEKATRFGTAKGAVEAKRAPIDFIPAGSFVRVAMLNGVDAPTGGQAQSNPLPVA
FHVIDVANLANKHKLDIKDCRFIAAAWGDLSSERMMGRTETLSCIINGETVEMPVKGQVIGEDGKTGVRG
RLVTKQGQLLANALFAGTLSGIGQAIQQSSSIVNSGAGGMTQIVDPDKVAQAGLGGGLGSASNMLAQYYL
KAADKLFPVIETDGGRTVEILITKGAVYDGKALAKEEYRGLLKRSSTRNRSYQDD
 
Nucleotide Sequence: 1428 bp     [Download]
>gi|330399456|ref|NC_014723.1|:59124-60551 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
GTGGCGTGCGCGCAGTCGCCATCGAGCATCAGACGTTGCCACCGGGGGAATCGACAAACATCTTCATTGT
GCGAGAGCGCAAAGACAATGATTGATCCGAATTCCCAAATCAAGAAGCGCCAGATGCTGCTAACCGGTAG
TGCTGTGGCTGGCATCATCGTGCTGATCGGCGCTGGCATGTTCCTGTTTGACAGCGGTCCGACCCACCAC
CGAGAAAAGCCCAAGACCGTCTCCATCACCGCGCCCGGCACGGTGGACGACAAGGACGCTTGGCGTGCTC
AGCAGGCAGCGGCCGAAAAGGCGAATTCTACTCGCATTGACGAGGTAAAGGCTCAACTCACGGCGCAGGA
AGAAGCCAACAAGCGGCTCGCCCAGGCGCTGGAAGAGCTAAAGGCAGGCAAGGCGGCTGACGCCGGCGCA
AGCTCACTGGCTGCCGATGTTTCCGTGCTCGACAAGCCACTGCCTACCAGACATACCGGCGCCGGTCAGC
GCGTATTGAACTCTCCGACCGGCAACAGTGAATCCGGCATATTGAACCAGCCGCTCAACTCTGCGCCCGA
GCCGCCTAAGCGCGAATTGGAGATGATTACCTTCGGCTTGCCGGGCGGCAAGGTCGGCATGGATGGTCTG
CGCGCCGGTGCGGCAGACGGGAACGCGGAAGGGGGCGGCTTCCGGAGCAACGAGAAAGCTACGCGGTTTG
GGACGGCAAAAGGGGCCGTCGAGGCCAAGCGTGCTCCTATAGATTTCATCCCTGCTGGCTCTTTCGTTAG
GGTAGCGATGCTCAACGGCGTGGATGCGCCCACTGGCGGCCAGGCGCAAAGCAACCCGTTACCGGTGGCC
TTTCACGTAATTGACGTGGCTAATCTGGCCAATAAGCACAAGCTTGACATTAAGGACTGTCGGTTCATCG
CCGCAGCGTGGGGCGACCTCTCCTCCGAACGGATGATGGGCCGCACCGAAACGCTGAGCTGCATTATCAA
CGGCGAGACGGTCGAGATGCCCGTCAAGGGCCAAGTGATCGGTGAAGACGGCAAGACTGGCGTGCGTGGC
CGCCTCGTCACCAAGCAGGGCCAGCTGCTCGCTAACGCGCTCTTTGCCGGCACGCTGTCTGGCATTGGTC
AGGCGATTCAGCAGTCTTCTTCCATCGTGAATTCCGGTGCTGGTGGAATGACGCAGATAGTCGACCCGGA
CAAGGTGGCTCAAGCCGGCCTCGGCGGTGGTTTGGGTAGCGCCTCCAACATGCTTGCACAGTACTACCTT
AAGGCCGCGGACAAGCTGTTTCCTGTCATTGAAACGGACGGTGGCCGTACTGTCGAAATTCTCATCACTA
AAGGTGCCGTGTATGACGGCAAGGCGCTTGCCAAGGAGGAATACCGGGGGTTGCTCAAACGCTCCAGTAC
CCGCAACAGGAGTTATCAAGATGACTAA
 Primer design