SecReT4
Protein ID: 330399522
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00658
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]61236..61934 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDE5AVZ6
KEGG IDbrh:RBRH_00658
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.7e-21, Aligned region: 47..145
Protein Sequence: 232 a.a.     [Download]
>gi|330399522|ref|YP_004030620.1| hypothetical protein RBRH_00658 [Burkholderia rhizoxinica HKI 454]
MARRRQASGSARSGPMKPVVKTRAMALSLGAMLALCGCVSMSGLDAKSNFACKVPDGIFCESMSGIYANA
QANDLPGQRMDQRAKTDPLIALSQAKGVLTKPLYSGTPIRSAPRLLRVWFSPWEDSDGDLHDQSYVYLQV
DSGRWLIEHNQRRIQDAYRPVRAPASATMSQSPGAAQDCQACQDQQYGQAAVQGGEAEEVVIGVRQDRMS
DAQAAQFLDGVLTPGDVAPQAK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|330399456|ref|NC_014723.1|:61236-61934 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGGCTAGACGACGGCAAGCCAGTGGCTCAGCAAGGAGCGGTCCAATGAAGCCTGTGGTGAAGACGAGAG
CAATGGCCTTGAGCCTGGGGGCTATGCTGGCTCTGTGCGGTTGCGTCAGCATGTCTGGCCTCGATGCGAA
ATCTAACTTTGCGTGCAAGGTGCCAGATGGAATTTTTTGTGAGTCCATGAGCGGCATCTATGCCAATGCC
CAGGCAAACGACCTGCCTGGCCAGCGCATGGACCAGCGTGCGAAAACTGATCCTTTGATTGCGCTTTCGC
AGGCGAAAGGCGTGTTGACCAAGCCGCTCTACAGTGGCACACCGATCCGTAGTGCGCCGCGGCTGCTGCG
CGTGTGGTTTTCTCCTTGGGAGGACTCGGACGGTGATTTGCACGACCAGAGCTACGTTTACTTACAAGTC
GATTCAGGCCGCTGGTTAATCGAACACAATCAGCGTCGCATCCAGGACGCCTACCGTCCGGTACGCGCGC
CGGCCAGCGCCACCATGTCGCAATCGCCCGGCGCAGCGCAAGACTGCCAAGCCTGCCAGGATCAACAGTA
TGGCCAAGCTGCTGTCCAGGGCGGTGAAGCGGAAGAAGTAGTAATCGGTGTGCGTCAGGACCGCATGAGC
GACGCCCAAGCTGCGCAATTCTTGGACGGCGTGCTAACGCCTGGCGACGTAGCGCCACAGGCCAAATAG
 Primer design