SecReT4
Protein ID: 330399523
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00657
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]61984..64593 [+]
ProductTraC protein
Component typeTraC_F
UniProt IDE5AVZ7
KEGG IDbrh:RBRH_00657
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3e-53, Aligned region: 487..775
TraC_F_IV [PF11130], Evalue: 1.1e-52, Aligned region: 45..288
Protein Sequence: 869 a.a.     [Download]
>gi|330399523|ref|YP_004030621.1| TraC protein [Burkholderia rhizoxinica HKI 454]
MQETAIEKLKGAAAKFWNETVLGNASDVGKQPAPVEMANEITSLYGLHRILKYDQYDESTGLFYNDNSVS
FCFELIAQTGADEDMTNRLTTLFTPIPPHTGIQWCLFGSPILDEPFQAYLDQRHIAVDNERTPPFFQDLA
KRRVEYIYKKGTPLWPNDNYFVKNIRLLVSITKAGSHRDSKLVEEMYELRETLRASLRTASLPAFPLNAD
GLIHFLWPILNPECMFDQEPLPDLHYDDGKSIKDQVTRFGQHARVKANEILFGLPPEQESDDDTRIAVRG
FGVLQYPKKKELWEMANIIGAFFDDGLQYPCPFLVCGGVFTLDPNVVDTKAQFKAARTKQNAKSKMAEFQ
PALHMQANDWDIVLHQLNNGGSMCELYHTLLLFAPKKIINRASQVALNIWRSERFTICPLRLLQLPALYA
SLPMTLTEQVRDDLQKMRLLTNKTTVNAVDMSPVIGEWKGAGDPVMMFFGRRGTPTFLDFYSNQQGNYNV
FVAGVSGSGKSVAMNEVVSAYRGIGARVWVMDVGRSYRNLVALQRGTFLEFTPSMKICINPFSWVGTDNE
LDFKAEMRMLKPMIGRMASPNAPLTEFQYALIAEAITETWNDYGQETNPTRIRDYLQSKIKNESGGVERV
AYELAKQLQPFTKEGVYGDFFDGRANISLDVDMVGLELEELKNAPELRRVVLYVLTSRIAHDMYLSRNRK
KLCLIDEAWQLLDSDKETAEFIEEGYRRARKYKGIFCLGTQGIEDAFKNDASRAAYNNADWKILLRQDRK
NLEKLIEDGMVNFSPAVKRMLLSLRTEKNRFSEMLISSPNGDAVVRHIPDPFSLLMASTNADDFNECEAL
LQQGYTTMQTLEIMLQRRGYTSHSHQRPG
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|330399456|ref|NC_014723.1|:61984-64593 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGCAAGAAACGGCGATAGAAAAGCTAAAAGGCGCCGCAGCCAAGTTTTGGAACGAAACAGTGCTGGGAA
ACGCTTCTGACGTGGGCAAGCAGCCCGCGCCGGTGGAGATGGCCAACGAAATTACCAGCCTATACGGGTT
GCATCGCATTCTCAAATATGACCAATACGATGAGAGCACCGGGCTGTTCTACAACGACAACTCCGTGTCC
TTTTGTTTTGAGCTTATCGCGCAGACCGGCGCCGATGAGGACATGACGAATCGGTTGACGACGCTCTTTA
CACCGATTCCTCCACACACCGGCATACAGTGGTGCCTGTTTGGTAGCCCGATCTTAGATGAGCCGTTTCA
AGCCTATCTGGACCAGCGGCACATCGCGGTGGATAACGAACGTACCCCACCGTTCTTTCAGGATCTGGCT
AAGCGCCGCGTCGAATACATTTACAAGAAAGGCACTCCGCTTTGGCCGAACGACAACTATTTTGTTAAGA
ACATTCGCCTGCTTGTATCCATCACCAAAGCAGGTTCTCACCGAGACAGCAAGCTGGTGGAGGAAATGTA
CGAGTTGCGCGAGACGTTGCGCGCGTCACTGCGTACAGCGAGCCTGCCAGCTTTTCCCTTGAACGCCGAT
GGCCTCATTCATTTCCTGTGGCCTATCCTCAATCCCGAGTGCATGTTTGACCAGGAACCGCTGCCGGACT
TGCATTACGACGATGGAAAGTCGATTAAAGACCAAGTGACCCGGTTTGGTCAGCACGCGCGTGTCAAAGC
CAACGAAATCCTGTTTGGCCTGCCGCCCGAGCAAGAGAGCGATGACGATACTCGCATAGCCGTGCGCGGC
TTTGGTGTATTGCAGTACCCGAAAAAGAAAGAACTGTGGGAGATGGCCAACATCATCGGCGCCTTCTTTG
ACGACGGTCTGCAGTACCCCTGCCCGTTTTTGGTCTGCGGCGGCGTCTTCACGCTCGACCCGAATGTGGT
GGACACCAAAGCGCAGTTCAAAGCTGCCCGCACCAAACAAAACGCCAAGTCCAAGATGGCTGAGTTTCAG
CCCGCGCTGCACATGCAGGCGAACGATTGGGACATTGTACTTCACCAGCTTAACAACGGTGGCAGCATGT
GCGAGCTATATCACACGTTGCTGCTGTTTGCGCCCAAAAAGATAATCAACCGGGCCAGCCAGGTCGCGCT
CAACATTTGGCGAAGCGAGCGCTTCACCATCTGTCCGCTGCGACTATTGCAACTGCCCGCGCTGTACGCC
AGTCTGCCCATGACGTTGACCGAGCAGGTGCGCGACGACCTGCAGAAGATGCGTTTGCTCACCAACAAGA
CCACCGTGAATGCAGTGGATATGTCACCAGTGATTGGCGAATGGAAAGGCGCGGGTGATCCAGTAATGAT
GTTTTTCGGCCGGCGCGGCACGCCGACTTTCCTGGACTTCTATAGCAACCAACAGGGCAATTACAACGTC
TTCGTGGCTGGCGTGTCAGGTTCCGGCAAGTCCGTGGCCATGAACGAGGTGGTGTCGGCCTATCGTGGCA
TCGGTGCTCGCGTGTGGGTGATGGATGTAGGCCGTTCCTATCGGAACCTCGTCGCATTGCAGCGTGGCAC
GTTCCTGGAATTCACACCCAGCATGAAAATTTGCATCAATCCCTTCAGCTGGGTGGGCACGGACAACGAG
CTAGATTTCAAGGCCGAAATGCGGATGCTCAAGCCGATGATCGGCCGTATGGCATCCCCGAACGCGCCGC
TCACGGAATTTCAGTATGCGCTCATTGCGGAGGCCATTACTGAGACTTGGAATGATTACGGGCAGGAAAC
CAATCCCACCCGGATTCGCGATTACTTACAGTCCAAAATCAAGAACGAATCGGGCGGAGTCGAGCGCGTG
GCCTACGAGTTGGCCAAACAACTCCAGCCATTTACCAAGGAAGGCGTGTACGGTGATTTCTTTGACGGTC
GCGCCAATATCAGTCTGGACGTCGATATGGTGGGACTGGAACTGGAAGAACTCAAAAACGCGCCCGAACT
GCGCCGCGTGGTGTTGTATGTGCTCACTAGCCGTATCGCCCACGACATGTATCTGTCTCGCAATCGCAAA
AAATTGTGCTTGATAGACGAAGCTTGGCAGCTTCTCGATTCAGACAAAGAGACCGCTGAATTTATTGAGG
AAGGCTATCGTCGTGCGCGCAAGTATAAGGGAATTTTTTGTCTTGGTACCCAGGGCATTGAGGACGCTTT
CAAGAATGACGCGTCACGGGCTGCCTACAACAATGCCGACTGGAAGATTCTGCTGCGTCAGGATCGCAAG
AACCTGGAAAAGCTGATTGAGGACGGTATGGTGAATTTCTCGCCGGCTGTGAAGCGGATGCTGCTGTCGC
TGCGCACTGAGAAAAACCGCTTTTCTGAGATGCTCATTTCGTCGCCCAACGGCGATGCTGTGGTGCGCCA
CATCCCCGATCCGTTCTCGCTGCTGATGGCCTCGACCAACGCGGACGACTTCAACGAGTGCGAGGCGCTA
TTGCAGCAAGGCTACACGACGATGCAAACCCTGGAAATCATGTTGCAGCGCCGTGGCTACACCAGTCACT
CTCATCAGCGCCCTGGATAA
 Primer design