SecReT4
Protein ID: 330399527
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00654
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]65464..66120 [+]
ProductTraW protein
Component typeTraW_F
UniProt IDE5AW01
KEGG IDbrh:RBRH_00654
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 5.8e-06, Aligned region: 13..41
Protein Sequence: 218 a.a.     [Download]
>gi|330399527|ref|YP_004030625.1| TraW protein [Burkholderia rhizoxinica HKI 454]
MMSLEGPMRFSKLIAAWLAAAMLPAANAVHLGVIGQTYPIGEESALDMIMKKLRQKERTGELKKLQEQAI
QRSMDSVKHMKPVEGITAVAERAQRLIDPTVTYAKAVTTDDGRIVIPAGTQINPLDMMNLTKTLVFFDGR
DAAQCKAVHKLVAQGPARLKPILVAGSWLDLTQAWKTQVFYDQHGSLTRRFGIKAVPSVIRQQGKMLLVE
EIPAKELQ
 
Nucleotide Sequence: 657 bp     [Download]
>gi|330399456|ref|NC_014723.1|:65464-66120 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
TTGATGTCATTGGAAGGGCCTATGAGGTTTTCTAAACTAATCGCGGCCTGGCTAGCCGCGGCGATGCTTC
CTGCTGCCAATGCTGTCCATTTGGGCGTCATCGGGCAAACTTACCCGATTGGCGAGGAAAGCGCGCTTGA
CATGATCATGAAGAAATTGCGCCAAAAAGAGCGTACCGGCGAGTTGAAGAAACTGCAGGAGCAAGCGATC
CAGCGCTCGATGGACAGCGTCAAGCACATGAAGCCCGTTGAAGGCATCACCGCCGTGGCCGAGCGCGCCC
AGCGTTTGATCGACCCGACCGTCACCTATGCCAAGGCTGTCACCACCGACGATGGACGCATTGTCATCCC
GGCGGGCACCCAGATTAACCCGCTGGACATGATGAACCTGACAAAGACCTTGGTGTTCTTTGACGGGCGC
GATGCCGCACAGTGCAAAGCCGTGCACAAGCTGGTCGCGCAAGGGCCGGCTCGCCTAAAGCCGATCTTGG
TGGCCGGATCCTGGCTGGACCTGACCCAAGCTTGGAAGACTCAGGTGTTTTATGACCAGCACGGCTCGCT
GACCCGGCGGTTCGGCATCAAGGCCGTGCCTTCCGTGATTCGCCAGCAAGGAAAGATGCTGCTCGTCGAG
GAGATTCCCGCGAAGGAGTTGCAATGA
 Primer design