SecReT4
Protein ID: 330399528
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00653
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]66117..67118 [+]
ProductTraU protein
Component typeTraU_F
UniProt IDE5AW02
KEGG IDbrh:RBRH_00653
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5e-84, Aligned region: 27..328
Protein Sequence: 333 a.a.     [Download]
>gi|330399528|ref|YP_004030626.1| TraU protein [Burkholderia rhizoxinica HKI 454]
MKRRLVAVCIFLFVTFAHESLAGVCQGKFANPITDICWSCLFPITLGGIRIMTMGQEDTGNPGGFLCTCT
DPLRIGIKTAFWEPARRVDVTRTPYCFVSLGGIKIDPGIRAPEGEVRLQQDNTKQSSYQVHWYIDPILYW
LEVLLDFICLETGSFDVAYITEVDPTWNDDELTMLLNPETFLFGNPIAQAACAGDCVLSSFGFGSNVLFW
CAGCQGSIYPLNGHVQAHVSHVQASSLLVQRMTAKLHREFLMWGTSGEDGLCGIYPSPVMDKTQYKYHML
YPIPQTQKINRRCCQPYGRTTALWGAGRSYPYKGEDFAYMIFRKKNCCLGVGF
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|330399456|ref|NC_014723.1|:66117-67118 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGAAACGCAGGCTTGTCGCCGTCTGCATATTTCTGTTCGTCACTTTCGCGCACGAGAGCTTGGCCGGGG
TGTGCCAGGGCAAGTTTGCCAACCCGATTACCGACATTTGCTGGAGCTGCCTGTTTCCAATCACACTCGG
GGGCATCCGAATCATGACGATGGGCCAGGAAGACACCGGTAATCCAGGTGGCTTTCTCTGCACCTGCACC
GACCCTTTGCGTATCGGAATTAAGACCGCCTTTTGGGAGCCGGCGCGGCGCGTGGACGTGACCCGCACGC
CGTACTGCTTTGTTTCGCTGGGCGGTATCAAGATCGATCCTGGCATTCGTGCGCCAGAAGGTGAAGTGCG
CCTGCAACAGGACAACACGAAGCAGTCCAGCTATCAAGTTCACTGGTACATCGACCCCATCCTTTACTGG
CTCGAGGTGCTATTAGACTTCATATGCCTTGAAACGGGTTCTTTTGACGTTGCCTACATTACCGAGGTCG
ATCCAACTTGGAATGACGATGAGCTGACGATGCTACTGAACCCGGAGACCTTTCTGTTCGGCAACCCTAT
TGCTCAGGCCGCGTGCGCTGGCGACTGCGTACTGTCGTCCTTTGGTTTTGGCAGCAATGTCCTGTTCTGG
TGTGCGGGCTGCCAAGGATCGATTTACCCATTAAACGGCCACGTACAAGCGCACGTGTCGCACGTGCAGG
CAAGTTCACTGCTGGTGCAGCGCATGACCGCTAAGCTGCACCGCGAATTCCTCATGTGGGGCACATCGGG
CGAGGATGGTTTGTGCGGCATTTATCCGTCACCGGTCATGGACAAGACCCAATACAAATACCACATGCTC
TATCCGATACCGCAAACGCAAAAAATCAATAGACGCTGTTGTCAGCCCTATGGGCGCACGACGGCCTTAT
GGGGAGCCGGCAGGAGCTATCCCTATAAAGGTGAGGATTTTGCCTACATGATTTTCCGTAAGAAAAATTG
CTGTTTGGGAGTGGGATTCTGA
 Primer design