SecReT4
Protein ID: 330399529
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00652
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]67094..67891 [+]
Productsex pilus assembly and mating pair formation protein
Component typeTrbC_F
UniProt IDE5AW03
KEGG IDbrh:RBRH_00652
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 1e-29, Aligned region: 134..243
Protein Sequence: 265 a.a.     [Download]
>gi|330399529|ref|YP_004030627.1| sex pilus assembly and mating pair formation protein [Burkholderia rhizoxinica HKI 454]
MLFGSGILMKKVGIGLMLLATFVRASVAQGTPTASEVDQERQRIETQRKQMFDASNPATLTRKGAMPSVH
DIERERQKVERERKSMFDANNPAIQNSANVFPNVPTPERVGIDIEAITRQYERKAEARKMDDLMIFASFT
MPRESLKRLVSQANRVGASVVLYGFKNNSFKDTVQAINALDEPAGNVVVNPNAFNKYKIKVVPTIVLAEA
ATLDSVDNEGRALHDQFAAVAGDVSLDYALDEIGRNLPQFNHVANRYIQQLRGHP
 
Nucleotide Sequence: 798 bp     [Download]
>gi|330399456|ref|NC_014723.1|:67094-67891 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
TTGCTGTTTGGGAGTGGGATTCTGATGAAGAAGGTTGGCATTGGATTGATGCTGCTTGCTACGTTTGTAC
GGGCAAGCGTGGCGCAGGGCACACCGACCGCGTCTGAGGTGGATCAAGAGCGTCAACGTATTGAGACGCA
ACGCAAGCAGATGTTTGATGCCTCCAACCCGGCCACCCTGACGAGGAAAGGCGCCATGCCCAGCGTGCAC
GATATCGAGCGCGAGCGCCAGAAGGTAGAGCGGGAGCGTAAATCCATGTTCGACGCAAATAACCCAGCCA
TCCAAAACTCGGCCAACGTGTTCCCGAACGTACCGACGCCCGAGCGGGTCGGCATCGATATCGAGGCGAT
TACCCGACAGTACGAGCGTAAGGCCGAGGCACGTAAGATGGACGATCTGATGATCTTCGCCAGCTTCACC
ATGCCGCGCGAATCGCTCAAGCGATTGGTGAGCCAAGCCAACCGCGTGGGCGCATCGGTTGTGCTGTATG
GCTTCAAGAATAATTCCTTTAAGGACACCGTGCAGGCAATCAACGCGCTGGATGAGCCGGCCGGCAACGT
GGTAGTGAATCCAAATGCCTTCAACAAGTACAAGATTAAAGTGGTGCCGACCATCGTGTTGGCCGAGGCG
GCCACACTAGACAGCGTGGATAACGAGGGCCGCGCGTTGCATGATCAATTTGCAGCGGTGGCCGGGGATG
TCTCTCTAGACTATGCCCTTGATGAGATCGGGCGCAACCTGCCGCAGTTTAACCACGTGGCAAACCGCTA
CATTCAGCAGCTCAGAGGGCACCCATAA
 Primer design