SecReT4
Protein ID: 330399530
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00651
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]67891..68967 [+]
Productconjugative transfer aggregate stability protein
Component typeTraN_F
UniProt IDE5AW04
KEGG IDbrh:RBRH_00651
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 358 a.a.     [Download]
>gi|330399530|ref|YP_004030628.1| conjugative transfer aggregate stability protein [Burkholderia rhizoxinica HKI 454]
MRVFYFATLAVLAAIAARAENSINTQADAFNAGKAFANDAKDAAVGKVNGDTGSQQLPYYGTSAPEAAHF
QGGRNLIGANGTNKQNACQSYRASDAFQQQECDAVNFLSKTPATRPKYTIDKKTDPLLTGSKSVIDNPGP
VPGAHTQRCRVEKVIHPATFITETCTESQTLENVKCRRGFSANVGTIVETPYFEVDHGVNVPPWTAQTYT
MNFHVNGNPERLILTWYRVDNYGQLWINGTKVFENVLSGYGDMRWGSVGQELIGRGLRRQRRIVYKDRHG
VSMGHFYDDGCNWGCLGVSPNLDITPHFKEGNNEIVLVCANANDIGPCTVKIVGSAKRLVMLGSLIDNQC
ATLEQRAQ
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|330399456|ref|NC_014723.1|:67891-68967 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGCGTGTCTTTTATTTCGCTACGCTGGCCGTGCTTGCTGCTATTGCCGCGCGTGCCGAAAATTCCATCA
ACACTCAAGCTGACGCCTTTAACGCCGGCAAGGCATTTGCCAATGATGCAAAGGACGCCGCGGTCGGCAA
GGTCAATGGCGACACTGGCAGTCAGCAGTTGCCTTACTACGGAACTAGCGCGCCGGAGGCCGCGCATTTT
CAAGGCGGGCGCAATTTAATCGGCGCGAACGGCACGAATAAGCAAAATGCCTGCCAATCCTACAGAGCTT
CCGACGCCTTTCAGCAACAGGAATGCGATGCGGTCAATTTTTTGTCGAAGACGCCGGCTACCCGGCCCAA
GTACACCATCGACAAGAAAACGGATCCGTTATTAACGGGTTCAAAATCCGTCATCGACAACCCAGGTCCC
GTGCCGGGAGCCCATACTCAGCGATGCCGGGTGGAGAAAGTCATTCACCCAGCGACATTCATCACCGAAA
CCTGTACAGAATCTCAAACGCTTGAGAACGTGAAATGCAGGCGGGGTTTTTCAGCAAACGTCGGCACGAT
AGTCGAAACCCCGTATTTTGAGGTTGATCACGGCGTCAACGTGCCTCCATGGACGGCGCAAACGTACACG
ATGAATTTTCACGTCAACGGCAACCCGGAGCGCCTTATACTGACTTGGTATCGGGTTGATAATTACGGTC
AACTGTGGATCAATGGCACTAAGGTCTTCGAAAACGTGCTCAGTGGCTACGGCGATATGCGTTGGGGCAG
CGTCGGTCAAGAATTAATCGGCAGGGGATTGCGGCGCCAGCGAAGAATTGTTTATAAAGATCGCCATGGC
GTCTCGATGGGCCACTTCTATGATGATGGGTGTAATTGGGGTTGCCTTGGTGTGTCGCCCAATCTCGATA
TTACGCCGCACTTTAAGGAGGGCAATAACGAGATCGTTTTGGTTTGTGCAAACGCGAACGATATTGGCCC
CTGCACGGTAAAAATCGTCGGCAGCGCCAAAAGGTTGGTCATGCTAGGCTCGCTCATTGATAACCAATGC
GCAACGTTAGAGCAAAGAGCGCAATGA
 Primer design