SecReT4
Protein ID: 330399533
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00648
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]70584..71372 [+]
Productconjugal transfer protein TraF
Component typeTraF_F
UniProt IDE5AW07
KEGG IDbrh:RBRH_00648
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 1e-64, Aligned region: 35..251
Protein Sequence: 262 a.a.     [Download]
>gi|330399533|ref|YP_004030631.1| conjugal transfer protein TraF [Burkholderia rhizoxinica HKI 454]
MLKRTLLALVIVSGVAHAESVLDYPSVWKCDTDKFNWYCDMDEGPGKIRQPATQPVKPKRIELKDIKTAA
QLRQELKRREDVAVMNPTDQNLKDYLELWQLTQSKGAVFADNWRRVVWQNPDFDYTLKRPANNSAIKVYD
AARLRNEAQQLRRLAKDHGLIFFFSSHCSYCHAMAPTLKVLADKFGLDVLGVSLDGGGLPEFPNPRDGRA
QAVAWGIERVPALFIGSKHTGDLAPIGFGMMALSEIVNRIFVLTATKPGDNF
 
Nucleotide Sequence: 789 bp     [Download]
>gi|330399456|ref|NC_014723.1|:70584-71372 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGCTGAAGCGAACCTTGCTTGCCCTTGTCATCGTTTCGGGTGTTGCCCATGCCGAGAGTGTCTTAGATT
ATCCCTCGGTCTGGAAGTGCGATACCGACAAGTTCAACTGGTATTGCGACATGGACGAGGGCCCGGGGAA
GATCCGGCAGCCGGCTACGCAGCCGGTCAAGCCCAAGCGCATCGAACTGAAGGACATCAAGACAGCTGCG
CAGCTGCGCCAGGAGCTAAAGCGCCGCGAGGACGTGGCGGTGATGAACCCCACCGACCAGAATCTGAAGG
ACTACCTCGAACTGTGGCAGCTTACGCAGAGCAAGGGCGCGGTGTTCGCGGACAACTGGCGGCGTGTGGT
CTGGCAAAACCCGGACTTCGACTACACGCTCAAGCGGCCGGCTAACAACTCAGCGATCAAAGTCTATGAT
GCGGCGCGTCTGCGGAACGAGGCACAGCAACTACGCAGGCTGGCCAAAGACCACGGCCTGATTTTCTTTT
TCAGCAGCCACTGTTCATATTGCCACGCCATGGCACCGACATTAAAAGTGCTGGCCGACAAGTTCGGTCT
TGACGTGTTGGGCGTGTCTTTGGACGGTGGGGGGCTACCTGAGTTTCCGAACCCGCGAGATGGTCGTGCG
CAGGCCGTTGCCTGGGGCATTGAACGTGTGCCGGCCCTGTTTATCGGCTCTAAGCATACCGGCGATCTTG
CGCCTATCGGCTTCGGGATGATGGCACTGTCGGAAATCGTCAATCGAATTTTTGTGTTGACTGCCACCAA
GCCGGGTGACAATTTTTAA
 Primer design