SecReT4
Protein ID: 330399534
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00646
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]71383..72786 [+]
ProductTraH protein
Component typeTraH_F
UniProt IDE5AW08
KEGG IDbrh:RBRH_00646
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 8.7e-105, Aligned region: 24..382
Protein Sequence: 467 a.a.     [Download]
>gi|330399534|ref|YP_004030632.1| TraH protein [Burkholderia rhizoxinica HKI 454]
MLRKKVIALVMALASSSFSYAMSMQELFDSVNAQGNVSNPAVLQGQTMNLYTGGSLFMRMPKRAYQLATS
TPPSWGAGCGGIDLYMGGFSYINKEQFVAMMRNIGSNALGYGFKLAIQNLCPTCDNVMQALQATAQQINR
LNMDSCEAAKGIVNAALPNTWERGKQNAAKNYGVDMNLFENITDAWTNVMNNERKANEPIERAKNTRPEA
RDALPSGNVVWKALKKLDGITDEHRMILMSMMGSTIFSTDTLGRPRALIPKEITVEELVGARSTSDQITV
PIWRCDTTSTEGCLHPVEDTITVKSFKAMVRQKMGAISGKIADRSAYDDMTAVLGFLNATDLPVYKMLAV
TTTMGNTSLADALISRYADLIAAKYAEIYIQRALIDLRAAIDKFSIVSDASQNEVLEDLKPKLESTSRAA
KQVLATAYSQTVSTYNIAQEVRHMERVMNANLSQTLRASLAFGKSLR
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|330399456|ref|NC_014723.1|:71383-72786 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGCTGCGCAAAAAAGTAATAGCGTTGGTCATGGCTTTGGCCTCGAGCAGCTTTTCTTACGCGATGTCGA
TGCAAGAGCTGTTCGATTCGGTCAACGCGCAAGGCAATGTCAGCAACCCGGCCGTGCTGCAGGGACAGAC
GATGAACCTCTATACCGGAGGTAGCCTATTTATGCGCATGCCCAAGCGCGCTTATCAGCTTGCCACGTCA
ACGCCGCCAAGCTGGGGTGCCGGCTGCGGTGGCATCGACTTGTACATGGGCGGCTTTTCTTACATCAACA
AAGAACAGTTTGTAGCCATGATGCGCAACATCGGCTCTAACGCGCTCGGCTACGGTTTCAAGCTGGCGAT
CCAAAACCTGTGCCCCACGTGCGACAACGTGATGCAGGCGCTGCAGGCGACCGCTCAGCAGATCAACCGG
CTCAACATGGACTCATGTGAGGCGGCCAAGGGCATCGTCAATGCCGCCCTGCCGAATACGTGGGAGCGCG
GCAAACAAAACGCTGCGAAGAATTACGGCGTCGATATGAACCTGTTCGAGAACATCACGGATGCATGGAC
TAACGTGATGAACAACGAAAGAAAGGCCAACGAGCCCATCGAACGGGCAAAAAATACCCGTCCGGAAGCC
AGGGACGCACTGCCAAGCGGAAACGTCGTGTGGAAGGCGCTCAAGAAGCTAGACGGAATCACAGATGAGC
ACCGCATGATTTTGATGTCAATGATGGGCAGCACTATTTTTTCCACTGACACATTGGGACGTCCTCGTGC
GCTGATCCCTAAAGAAATCACGGTGGAAGAACTGGTTGGCGCACGCAGCACATCCGACCAAATTACCGTG
CCGATTTGGCGTTGTGACACCACGAGCACGGAGGGCTGCCTGCATCCGGTCGAAGATACCATCACGGTTA
AGAGCTTCAAGGCGATGGTGCGGCAGAAGATGGGAGCGATTTCGGGCAAGATCGCCGACCGCTCCGCATA
CGACGATATGACGGCCGTGCTGGGCTTTTTAAATGCCACCGATTTGCCTGTCTACAAGATGCTAGCCGTC
ACCACGACAATGGGTAATACGTCGCTGGCCGACGCGCTGATCAGCCGCTATGCAGACCTGATCGCGGCCA
AATATGCCGAAATCTATATCCAGCGTGCACTCATCGACCTGCGTGCTGCAATAGATAAATTCTCGATTGT
ATCTGACGCCTCTCAGAACGAGGTGCTAGAAGATCTGAAACCAAAATTGGAGAGCACGTCCCGCGCGGCC
AAGCAAGTGCTGGCCACCGCCTACTCGCAAACCGTCAGCACCTACAACATTGCTCAAGAGGTGCGACATA
TGGAGCGGGTCATGAACGCGAACCTATCGCAGACCCTGCGCGCCTCGCTGGCCTTTGGCAAGAGCCTGCG
CTAA
 Primer design