SecReT4
Protein ID: 330399535
T4SS name [ID]Tra_F [548]
Gene symbol-
Locus tagRBRH_00645
StrainBurkholderia rhizoxinica HKI 454
Repliconplasmid pBRH02 [GenBank: NC_014723] [Browse all T4SS(s) in this replicon]
Location [Strand]72799..75849 [+]
ProductTraG protein
Component typeTraG_F
UniProt IDE5AW09
KEGG IDbrh:RBRH_00645
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 2e-101, Aligned region: 5..466
Protein Sequence: 1016 a.a.     [Download]
>gi|330399535|ref|YP_004030633.1| TraG protein [Burkholderia rhizoxinica HKI 454]
MIDIELHTYWNVETLYYVFNAVASVMSGAGFFGLLKYVFILAIALGIFAYAGNKQLEMAKWFFQALVFTS
LLNMPIARLVITDRTGLEPPRVVDRVPFALAGVAQANNLVFGFLTRTYETVFGVPDDLGLQKGDVGFGHR
ILKQVNKATVRDPGLRADLMQFIKECTFYDVRDGEITPQTIVGGTDTWKEVFSHTSPARFVTYDTLTSKP
TTDTCTSVAAILKQRVNDAVVAGQRFYGKQAFTRATSDAIATSMFMSAVGTSYDWILNNASNASDAIKQS
MFNNIWKEAGAELPVLLNDPARVSEVSALAGAAQAARQADGSNSTLSLLAQETLPHMRNWIEAIIYGLFP
VLVVLMVVLPTEGAKKVFGGYLMSLAWIGLWPVLFAMINHLSLMHLRYKARALELAAGVPFQLSDAFDAT
LSNEQAMIGYMVVLVPFIAGAVIRMGQGGFMSVSHQMFSGFASAGSAIGSNMASGNVSVGQAGLDTASVN
TTSMHKYDSNIGLSGGGATIGRGDGSVVTMAANGTVALQQFQNRMLMQMGLDKKFESSRNQEAHQTDITS
SGDQLAYRHSDVSNLTDVKGHDSTRGIYQQHGVQTSTTEQGGYGGQHTTGQSLGKDFREGSNFNMQAGAQ
DGLGMNLGVGKGSRGSSGARAAATGGGIDPREEKRITDSMKQGGATQQQINEALDNYRASKGGGAGSIFN
AGLGLDSRKIYSAEHGRNREVSTHHGLNEAAHTERNFSVTGARSEQSTSGQQSNQTDRHSRDATRLSAHE
RGHVLDESNRREYGAGNRVSRNETDSFSVHKDLMADPYLFDKVAARNGMTAMRFANQSENRIMEMVSDYV
TEKGMVEQSKTMPQHTFAGERLPITQSDLKEQAAKARAEIPENIASVHKNKVAQTGYYDARALNVDTSAP
PIVGSSKEGVYRQLDSKSRGSIPARAEALDENVNAWASPDKEVGAGRVNQMGVVEDMEVRDVKDYGKKVL
DKITGGDGTADGEKLSDNMKRESAANVQINTGGKKD
 
Nucleotide Sequence: 3051 bp     [Download]
>gi|330399456|ref|NC_014723.1|:72799-75849 Burkholderia rhizoxinica HKI 454 plasmid pBRH02, complete sequence
ATGATAGACATCGAACTTCATACCTACTGGAACGTCGAGACACTCTACTACGTGTTCAACGCGGTGGCGT
CTGTCATGAGTGGTGCCGGTTTTTTCGGCCTGCTCAAGTACGTTTTCATTCTCGCCATTGCCCTAGGCAT
ATTTGCCTATGCGGGCAACAAGCAACTCGAAATGGCCAAGTGGTTTTTCCAAGCACTGGTCTTCACATCA
TTGCTCAATATGCCAATCGCACGCTTGGTCATCACAGATCGGACGGGTTTGGAGCCGCCGCGTGTAGTGG
ATCGCGTACCGTTCGCACTGGCAGGGGTCGCTCAAGCGAACAATTTGGTGTTCGGTTTTCTCACACGGAC
CTACGAAACCGTCTTTGGTGTGCCCGACGATCTCGGGCTGCAAAAAGGCGATGTGGGTTTCGGCCACCGT
ATTTTAAAGCAGGTCAACAAAGCAACAGTGCGTGATCCAGGCTTGCGCGCCGACCTGATGCAGTTCATCA
AGGAATGCACGTTTTACGATGTGAGGGATGGTGAAATCACGCCACAGACAATCGTCGGTGGCACCGACAC
CTGGAAAGAGGTCTTCAGCCACACGAGCCCGGCGCGCTTTGTGACCTATGACACGCTGACCAGTAAGCCG
ACCACGGATACGTGCACCAGTGTTGCTGCCATCCTTAAACAACGAGTGAACGATGCCGTGGTGGCCGGTC
AGCGCTTTTATGGCAAGCAGGCCTTTACGCGGGCCACCTCCGACGCGATTGCCACCAGCATGTTCATGTC
CGCCGTGGGTACGTCCTACGACTGGATTTTGAACAACGCCAGCAATGCATCCGATGCCATCAAGCAGTCG
ATGTTCAACAATATTTGGAAAGAAGCGGGCGCCGAACTGCCAGTGTTGCTGAACGATCCCGCACGCGTGT
CCGAAGTCAGTGCCTTGGCTGGCGCCGCGCAAGCTGCACGTCAAGCGGATGGCTCCAACTCCACTTTGAG
CCTGCTGGCGCAGGAGACATTGCCTCATATGCGCAACTGGATTGAGGCGATCATTTATGGCCTTTTCCCA
GTTCTGGTAGTGCTGATGGTGGTGCTTCCTACGGAGGGGGCCAAAAAGGTATTTGGCGGTTATCTGATGT
CGCTGGCCTGGATCGGGCTGTGGCCGGTCTTGTTTGCCATGATTAACCATCTATCGCTAATGCACCTGCG
TTATAAGGCACGGGCGCTGGAGCTGGCTGCAGGCGTGCCGTTTCAGCTTTCCGATGCCTTCGACGCGACT
TTGTCCAACGAGCAAGCGATGATCGGCTACATGGTTGTGCTAGTGCCGTTCATTGCCGGTGCGGTCATTA
GAATGGGGCAGGGCGGCTTTATGTCCGTTTCCCATCAAATGTTCTCCGGTTTTGCTTCTGCTGGTTCAGC
CATCGGCTCTAACATGGCCAGCGGAAATGTAAGCGTGGGGCAGGCTGGCTTGGATACGGCCTCGGTTAAC
ACGACCTCGATGCACAAGTACGACAGCAACATCGGTTTGTCGGGTGGCGGTGCGACTATCGGCCGGGGCG
ATGGTTCAGTGGTCACGATGGCCGCTAACGGCACGGTGGCGTTGCAGCAATTCCAGAACCGGATGCTTAT
GCAGATGGGTTTGGACAAAAAATTTGAGTCTTCGCGCAATCAAGAGGCTCACCAAACCGACATCACTTCT
TCTGGCGACCAGCTGGCCTACCGTCACAGCGACGTATCTAATTTGACCGACGTCAAGGGCCACGACAGCA
CGCGAGGCATTTACCAGCAGCACGGTGTCCAGACTAGCACGACGGAGCAGGGCGGCTACGGTGGCCAGCA
CACGACCGGCCAGAGTCTAGGCAAGGATTTTCGCGAGGGGTCAAATTTTAACATGCAGGCCGGCGCTCAG
GATGGGCTGGGCATGAATCTGGGTGTCGGAAAAGGCAGTCGGGGCAGCAGTGGTGCCCGCGCCGCTGCAA
CCGGTGGCGGCATCGACCCGCGCGAAGAAAAGCGAATTACTGACTCGATGAAACAAGGCGGGGCAACGCA
ACAGCAAATCAATGAGGCGTTGGACAATTATCGTGCAAGCAAGGGCGGCGGTGCCGGCAGTATCTTCAAC
GCTGGCCTAGGTCTTGACTCGCGCAAGATTTACTCGGCTGAACACGGCCGCAACCGGGAAGTGTCCACTC
ACCACGGCCTAAACGAAGCAGCGCATACCGAGCGGAATTTCTCCGTCACCGGCGCGCGAAGCGAGCAGTC
GACATCGGGCCAGCAGTCAAACCAGACAGATCGCCATAGCCGCGACGCTACCCGCTTGAGCGCTCATGAA
CGTGGGCACGTACTCGACGAGTCAAATCGGCGCGAGTATGGGGCTGGCAACCGGGTCAGCCGTAACGAGA
CTGATTCCTTTTCGGTCCACAAGGATCTGATGGCCGACCCATACCTGTTCGATAAGGTGGCTGCGCGCAA
CGGCATGACCGCCATGCGTTTCGCCAATCAATCCGAGAACCGGATCATGGAAATGGTCAGCGACTATGTG
ACCGAGAAGGGCATGGTGGAGCAGTCCAAGACCATGCCGCAGCACACTTTCGCGGGCGAAAGACTGCCCA
TAACCCAGAGCGATCTCAAAGAGCAAGCGGCCAAGGCCCGCGCCGAGATTCCGGAGAACATTGCTAGCGT
CCACAAAAACAAAGTGGCTCAGACCGGGTATTACGATGCTCGCGCGCTAAACGTCGATACCAGTGCGCCA
CCCATCGTTGGCAGTTCCAAGGAGGGTGTGTACAGACAGCTCGATTCGAAGAGCAGGGGCAGCATACCAG
CGCGTGCTGAGGCTTTAGACGAGAACGTGAACGCCTGGGCAAGCCCGGACAAAGAGGTCGGCGCAGGGCG
GGTGAATCAAATGGGCGTTGTGGAGGACATGGAGGTCCGGGACGTCAAGGACTACGGTAAGAAGGTGTTG
GATAAGATCACGGGTGGTGATGGCACGGCTGACGGCGAAAAGCTTAGCGACAACATGAAGCGGGAAAGTG
CAGCTAATGTTCAGATCAATACGGGAGGAAAGAAAGACTAG
 Primer design