SecReT4
Protein ID: 330503816
T4SS name [ID]Trb [312]
Gene symbol-
Locus tagMDS_2902
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T4SS(s) in this replicon]
Location [Strand]3206906..3207247 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDF4DZA3
KEGG IDpmk:MDS_2902
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.4e-24, Aligned region: 10..102
Protein Sequence: 113 a.a.     [Download]
>gi|330503816|ref|YP_004380685.1| unnamed protein product [Pseudomonas mendocina NK-01]
MTACHPRVANSRRFVGALILGALCMGASLPVLAAGSGMPWEGPLQSILDSVQGPVARIIAVIIIITTGLT
LAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFAGGAVIA
 
Nucleotide Sequence: 342 bp     [Download]
>gi|330500914|ref|NC_015410.1|:3206906-3207247 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGACTGCCTGCCATCCCCGCGTTGCTAATAGTCGCCGCTTCGTCGGCGCTTTGATACTCGGTGCCCTAT
GTATGGGCGCTTCCCTGCCCGTGCTCGCCGCCGGCTCCGGCATGCCCTGGGAGGGACCGCTGCAATCGAT
CCTCGACTCGGTACAGGGTCCGGTGGCGCGCATCATCGCGGTGATCATCATCATTACCACAGGCCTGACG
CTGGCCTTCGGCGACACCAGCGGTGGATTTCGCAAGCTGATCCAGATCGTCTTCGGCCTGTCGATTGCCT
TCGCCGCGTCGTCGTTCTTCCTCAGCTTCTTCAGCTTTGCCGGCGGGGCGGTGATCGCATGA
 Primer design