SecReT4
Protein ID: 330503821
T4SS name [ID]Trb [312]
Gene symbol-
Locus tagMDS_2907
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T4SS(s) in this replicon]
Location [Strand]3210883..3212043 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDF4DZA8
KEGG IDpmk:MDS_2907
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 8.6e-49, Aligned region: 37..259
Protein Sequence: 386 a.a.     [Download]
>gi|330503821|ref|YP_004380690.1| unnamed protein product [Pseudomonas mendocina NK-01]
MNDVSVIDRFLEVFGLYIDTGFGLLGGEVAFLTMTLVVIDMTLAGLFWAMGGEDVSAKLIRKTLYVGAFA
FIIGNFNSLAKIVFNSFAGLGLLASGSGLSHAEFLQPGRLATIGVDTGGPLLEQISKLSGFPEVFSNLHS
ILVLFLAWLVVIVSFFFLAIQLFVTLVEFKLTTLAGFVLVPFALWNKTAFLAEKVLGNVVASGIKVLVLA
VIVGIGSGLFAEFQAVPEEPSIDHALVVMLASLALLGLGIFGPGIATGLVSGAPQLGAGAAAGTALGAVG
MAAGAAAVATGVGGAVLAGARMAPGAARLAVGGARSLAGAPSGATASGAPATSDPATAPAKQPDWARRLQ
RRQQLSQATSTVAHTLRGGDGGGSSPGPQIRDPSNS
 
Nucleotide Sequence: 1161 bp     [Download]
>gi|330500914|ref|NC_015410.1|:3210883-3212043 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGAACGACGTCAGCGTGATCGACCGATTCCTCGAGGTGTTCGGGCTGTATATCGACACCGGCTTCGGCC
TGCTCGGCGGTGAGGTGGCCTTTCTCACCATGACCCTGGTGGTGATCGACATGACCCTGGCCGGGCTGTT
CTGGGCCATGGGCGGTGAGGATGTCAGCGCCAAGCTGATCCGCAAGACCCTCTATGTCGGTGCCTTCGCC
TTCATCATCGGCAACTTCAATTCCCTGGCGAAGATCGTCTTCAACTCCTTCGCCGGGTTGGGTCTGCTGG
CCTCAGGTTCCGGGTTGAGTCATGCGGAGTTTCTGCAGCCAGGGCGATTGGCCACGATTGGGGTTGATAC
CGGAGGGCCGCTGCTTGAGCAGATCAGCAAGCTCAGTGGATTTCCCGAAGTTTTCAGCAACCTGCACAGC
ATTCTGGTGCTGTTTCTGGCCTGGCTGGTGGTCATCGTCAGTTTCTTCTTCCTGGCCATTCAGCTGTTCG
TGACCTTGGTCGAATTCAAGCTGACCACCCTTGCTGGCTTCGTGCTGGTGCCCTTTGCGCTGTGGAACAA
GACTGCCTTTCTCGCCGAGAAGGTGCTGGGCAACGTGGTCGCGTCCGGCATCAAGGTGCTGGTGCTGGCG
GTGATCGTCGGCATTGGCAGCGGGCTGTTCGCCGAGTTTCAGGCCGTCCCGGAGGAGCCCTCCATCGATC
ACGCGCTGGTGGTCATGCTCGCCTCGCTGGCTCTGCTCGGCCTGGGCATTTTCGGCCCGGGCATTGCCAC
CGGCCTGGTTTCCGGCGCACCGCAACTGGGTGCTGGTGCAGCAGCCGGCACTGCCCTCGGTGCAGTGGGC
ATGGCTGCTGGTGCTGCTGCAGTAGCAACAGGTGTCGGCGGCGCGGTATTGGCCGGCGCGCGCATGGCGC
CCGGTGCCGCGCGCTTGGCAGTGGGTGGCGCTCGCTCTCTGGCAGGAGCCCCCTCCGGCGCTACAGCAAG
TGGTGCCCCCGCCACTTCCGATCCTGCAACTGCCCCAGCCAAACAGCCCGACTGGGCCAGGCGCCTGCAG
CGCAGGCAACAGCTCTCACAGGCCACCAGTACGGTCGCCCACACCCTTCGTGGTGGCGATGGCGGTGGTT
CATCACCTGGGCCGCAGATCCGCGACCCATCGAATTCGTAA
 Primer design