SecReT4
Protein ID: 330503823
T4SS name [ID]Trb [312]
Gene symbol-
Locus tagMDS_2909
StrainPseudomonas mendocina NK-01
Repliconchromosome [GenBank: NC_015410] [Browse all T4SS(s) in this replicon]
Location [Strand]3212760..3213746 [+]
ProductP-type conjugative transfer protein TrbG
Component typeTrbG
UniProt IDF4DZB0
KEGG IDpmk:MDS_2909
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.7e-68, Aligned region: 101..320
Protein Sequence: 328 a.a.     [Download]
>gi|330503823|ref|YP_004380692.1| unnamed protein product [Pseudomonas mendocina NK-01]
MRTTQSIYICPLLLSVLAGCASQQPPVIALDEPVEAQRLPEPPRPIEVVEISQPLALPAQLKPLPETQRS
KPAKEPADERVRVSRANRDARVAPSREGYINAIQVWSYSDGALYQVYASPGRVTAINLQPGEELVTVAAG
DTVRWIVGDTTSGSGDELRTSVLIKPTRVDLKTNLVITTTRRTYLIELSSTEQAWMASVSWDYPKDRMLA
LQRRASAAQAAAPVDAGLALEQLRFRYAISGSNPPWKPLRAFDDGRKVYIQFPAGIAQGELPPLFVIGPE
GDGQLVNYRFRSPYYIVDRLFGAAELRLGADKSDVVRIERTDGVARRR
 
Nucleotide Sequence: 987 bp     [Download]
>gi|330500914|ref|NC_015410.1|:3212760-3213746 Pseudomonas mendocina NK-01 chromosome, complete genome
ATGAGAACTACCCAGAGCATTTACATCTGCCCTCTACTGCTGAGCGTGCTGGCCGGCTGTGCCAGCCAGC
AGCCGCCAGTGATCGCGCTGGATGAGCCGGTAGAAGCGCAGCGCCTGCCAGAGCCGCCCAGGCCCATCGA
AGTGGTGGAAATTTCCCAGCCCTTGGCACTGCCGGCGCAGCTCAAGCCATTGCCGGAAACTCAGCGCAGT
AAGCCGGCCAAGGAACCGGCCGATGAGCGCGTGCGGGTCTCACGTGCCAATCGCGACGCCCGCGTGGCAC
CGAGTCGCGAGGGCTATATCAACGCCATCCAGGTGTGGTCCTACTCCGATGGCGCGCTGTATCAGGTGTA
CGCCAGCCCAGGACGGGTGACCGCAATCAACCTGCAGCCCGGCGAGGAACTTGTCACCGTAGCCGCTGGC
GACACCGTGCGCTGGATCGTCGGCGACACCACCAGCGGAAGCGGAGACGAGCTACGCACCAGCGTGCTGA
TCAAGCCGACACGCGTCGACCTCAAGACCAACCTGGTGATCACCACCACGCGCCGTACCTACCTGATCGA
GCTGAGTTCCACCGAGCAGGCCTGGATGGCGTCGGTGTCCTGGGACTATCCGAAGGATCGCATGCTCGCC
CTGCAACGCCGTGCCAGTGCCGCTCAGGCCGCGGCGCCAGTGGATGCCGGCCTGGCGCTGGAGCAGTTGC
GCTTCCGCTATGCAATCAGCGGCAGCAATCCACCCTGGAAGCCGCTACGTGCCTTCGATGACGGCCGCAA
GGTGTATATCCAGTTCCCCGCCGGTATCGCCCAAGGCGAGCTGCCGCCGCTGTTCGTAATTGGCCCCGAA
GGTGACGGACAGCTGGTCAACTATCGTTTCCGCTCACCCTACTACATCGTCGACCGCCTGTTCGGCGCGG
CCGAGCTGCGCTTGGGCGCCGACAAGAGTGACGTGGTGCGGATCGAGCGCACCGACGGCGTGGCACGGAG
GCGCTGA
 Primer design