SecReT4
Protein ID: 330808762
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a1993
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2433361..2434770 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDF2KEZ4
KEGG IDpba:PSEBR_a1993
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 469 a.a.     [Download]
>gi|330808762|ref|YP_004353224.1| hypothetical protein PSEBR_a1993 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSARYPYVSTSPRFTNTRRLLSALLLLATASQAAQTELNKDGIHHSGSIGDDVLYSIGGGRAVSMGGSAA
MDSISVGAGWDTNLICGDMSLDTTLRNQLNGATGGFKSIMSNIIQNATSAVASLPALIIQRADPGLYNLL
TNGILQARLDFDRSKSTCRAVAERMADVAGGQLGWGALAEGMALSHTVKNHDAVAAVEQAEQHRGNNGVP
WVGGNSAGGKRQPPIKVVSDVTRAGFNLLNGRDVGNRSPIPKDSCGNRLSCQTWSSPQEAEAWATRVLGE
QEHQTCDHCTKTQTKPGVGLTPLIQEEYDAKLQSLEALVKGSKPTSAENLLAASSQSLPITRGVIEALRD
EPDQDLLARRLASEVALSSVLEKALMLQRTLLTGRKEPNVAANQLAQQAITSESEALTQEINSLKTELEL
RRTLAGSSPMMLIQRQSNRAAGSRGVYQGDPIRNRLDLIQQPVPEGHRP
 
Nucleotide Sequence: 1410 bp     [Download]
>ref|NC_015379.1|:c2434770-2433361 hypothetical protein PSEBR_a1993 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGCGCCCGCTATCCGTACGTCTCGACCTCGCCTCGATTTACCAATACCCGACGTCTACTTTCCGCCC
TGCTTCTCTTGGCCACAGCTTCCCAGGCAGCGCAAACAGAACTGAACAAGGACGGCATCCATCACAGCGG
TTCGATCGGTGACGACGTGCTCTATAGCATCGGTGGCGGACGCGCTGTGTCCATGGGTGGGTCTGCCGCC
ATGGACAGCATTTCGGTAGGTGCCGGCTGGGATACCAATTTGATCTGTGGCGACATGAGCCTCGACACCA
CGCTGCGAAACCAACTTAACGGTGCCACAGGCGGCTTCAAGTCGATCATGAGCAACATCATCCAGAACGC
CACCAGCGCTGTAGCCTCCCTTCCCGCTCTGATCATTCAGCGCGCCGATCCAGGCCTGTACAACCTACTC
ACCAATGGCATATTGCAAGCCCGGCTTGATTTCGACCGATCCAAATCTACGTGTCGGGCCGTGGCCGAAC
GCATGGCCGATGTTGCGGGTGGTCAGCTCGGTTGGGGAGCACTGGCCGAAGGTATGGCGCTCAGTCATAC
CGTCAAAAACCATGATGCTGTGGCAGCTGTTGAACAGGCGGAGCAGCATCGAGGCAACAACGGTGTACCT
TGGGTCGGCGGCAATTCGGCCGGGGGCAAGAGACAACCCCCCATCAAAGTGGTTTCGGATGTCACACGCG
CCGGCTTCAATTTGCTCAATGGCCGTGATGTCGGCAATCGTTCCCCCATACCGAAAGATAGCTGCGGCAA
CCGTCTGAGCTGTCAGACATGGTCCTCCCCGCAAGAAGCAGAAGCCTGGGCTACTCGTGTACTGGGAGAG
CAAGAGCACCAGACCTGCGACCACTGCACCAAAACACAAACCAAACCTGGCGTGGGCCTTACTCCGCTCA
TTCAGGAGGAGTACGACGCCAAGCTTCAATCCCTTGAGGCCCTCGTGAAAGGCAGCAAACCCACCTCAGC
GGAAAATCTGTTGGCGGCGAGCAGTCAATCACTCCCCATCACCCGGGGCGTGATAGAAGCACTGCGCGAT
GAACCGGACCAAGACTTACTGGCAAGACGCTTGGCATCCGAGGTGGCGCTCTCCAGTGTCTTGGAAAAAG
CACTCATGTTGCAGCGCACCCTGTTGACCGGACGCAAGGAACCCAACGTTGCTGCCAATCAACTGGCTCA
ACAAGCCATCACCAGCGAAAGCGAAGCCCTGACTCAGGAAATCAACAGCCTCAAAACCGAACTCGAACTT
CGGCGCACCCTGGCCGGCAGCTCACCAATGATGTTGATCCAACGTCAAAGCAATCGCGCCGCGGGATCAC
GTGGCGTCTACCAGGGCGATCCAATACGCAACCGTCTGGACCTGATCCAGCAGCCGGTGCCTGAGGGCCA
CCGACCATGA
 Primer design