SecReT4
Protein ID: 330808773
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_m644
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2446000..2446395 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDF2KF05
KEGG IDpba:PSEBR_m644
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.6e-44, Aligned region: 10..129
Protein Sequence: 131 a.a.     [Download]
>gi|330808773|ref|YP_004353235.1| hypothetical protein PSEBR_m644 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
METLHQSASDGTIIFLPHRLNRQPVVVRGLTADELWICTGLSATAGITLGIPAAWLASSIAVVPTAVVLT
IAAGLFIGGGLLRRQKRGRPETWLYRQIQWRLANKCPGLTRRFAYELITRSGVWTTRRGDA
 
Nucleotide Sequence: 396 bp     [Download]
>ref|NC_015379.1|:c2446395-2446000 hypothetical protein PSEBR_m644 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGAAACCCTTCATCAGAGCGCCTCTGACGGCACCATCATCTTTCTGCCCCACCGCTTGAACCGTCAAC
CTGTCGTCGTTCGAGGGCTGACCGCTGACGAGTTGTGGATCTGTACCGGATTATCTGCGACCGCAGGAAT
CACTTTGGGTATTCCTGCGGCGTGGTTGGCAAGCAGCATTGCAGTGGTACCTACTGCAGTTGTGCTGACA
ATTGCAGCAGGCCTTTTCATCGGTGGTGGCCTGTTACGTCGTCAAAAACGGGGACGACCCGAGACGTGGC
TTTATCGGCAGATTCAATGGCGGCTGGCCAATAAGTGTCCCGGACTGACCAGGCGATTTGCGTATGAGCT
GATTACTCGTTCTGGCGTCTGGACGACTCGTCGGGGTGACGCATGA
 Primer design