SecReT4
Protein ID: 330808776
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_cmegm45
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2447018..2447356 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDF2KF08
KEGG IDpba:PSEBR_cmegm45
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.1e-19, Aligned region: 32..104
Protein Sequence: 112 a.a.     [Download]
>gi|330808776|ref|YP_004353238.1| hypothetical protein PSEBR_cmegm45 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MIPLSHPKYAKAAVLLFALVGQSTAIANEIVDEHTRLATLLRELSAIERLTYTEDLIRDSGPSRRHFSYV
DLRADIQRVSMGIKSYLSPPRAAPRDVVDLHGSYLNDVVSDQ
 
Nucleotide Sequence: 339 bp     [Download]
>ref|NC_015379.1|:c2447356-2447018 hypothetical protein PSEBR_cmegm45 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGATCCCCCTCTCACACCCAAAATATGCCAAGGCAGCAGTGTTGCTATTTGCACTCGTAGGACAGAGCA
CTGCGATAGCCAACGAGATTGTTGATGAACATACCCGCTTAGCAACGCTCCTTCGCGAGCTGAGCGCAAT
TGAAAGGCTCACCTACACGGAAGATCTCATTAGAGATTCGGGACCGTCACGCCGGCATTTCAGTTATGTC
GACCTGAGAGCAGATATCCAACGCGTCAGCATGGGAATCAAAAGTTACCTGTCACCACCTCGAGCCGCGC
CGCGTGACGTTGTTGATCTGCACGGCAGCTACCTCAATGACGTGGTGTCTGATCAGTGA
 Primer design