SecReT4
Protein ID: 330808778
T4SS name [ID]Tfc [724]
Gene symbol-
Locus tagPSEBR_a2000
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T4SS(s) in this replicon]
Location [Strand]2448034..2448783 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDF2KF10
KEGG IDpba:PSEBR_a2000
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.4e-62, Aligned region: 47..246
Protein Sequence: 249 a.a.     [Download]
>gi|330808778|ref|YP_004353240.1| hypothetical protein PSEBR_a2000 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MSDPAATSQRQQAQQQGLFISLLTLPFRLIGVLCGSLILSIAIECAGMYFFWPEEGWYHSRRMFEFELAQ
MSKDFTRSALVQEPGRTAQALVLKVHEIVLVKTGIADSLQDTSNKARNAQNDRVHSGRYYLGTIYTYLEN
GLIAVAYTVLVFIVRLLVLVLTLPLFVTTAFVGLVDGLVCRDIRRFGAGRESGYIYHRAKACVIPLIIWP
WILYLALPVSLDAVLILLPSAALLGIVVALTASRFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>ref|NC_015379.1|:c2448783-2448034 hypothetical protein PSEBR_a2000 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGAGCGATCCCGCTGCGACAAGTCAACGTCAGCAGGCGCAACAGCAAGGGCTGTTCATCAGTCTGCTGA
CACTCCCCTTTCGATTGATCGGCGTACTGTGCGGGTCGCTGATACTTAGCATTGCGATCGAATGCGCCGG
CATGTACTTCTTCTGGCCCGAGGAAGGCTGGTACCACTCGCGACGGATGTTTGAGTTTGAACTGGCCCAA
ATGTCTAAAGACTTCACCCGAAGCGCGCTGGTGCAGGAGCCCGGACGTACCGCCCAAGCACTCGTCTTGA
AGGTACATGAGATAGTGCTGGTCAAAACCGGCATTGCTGACTCACTGCAGGACACATCGAACAAAGCGAG
GAACGCTCAGAATGATCGTGTTCACTCCGGTCGTTACTACCTTGGAACAATCTACACGTACCTGGAAAAC
GGCTTGATCGCCGTGGCATATACCGTGTTGGTGTTCATTGTCCGCTTGCTGGTGCTGGTTCTGACGCTAC
CGCTATTCGTGACGACTGCCTTTGTAGGGTTGGTAGATGGACTGGTCTGTAGGGACATCAGGCGGTTTGG
CGCAGGGCGTGAGTCGGGCTACATTTACCATCGAGCCAAGGCTTGTGTAATACCGCTGATTATATGGCCC
TGGATACTCTATCTGGCCTTACCGGTGAGCTTGGATGCAGTTTTGATCCTGCTTCCCAGCGCGGCTCTTT
TGGGTATCGTGGTAGCTCTTACGGCAAGCAGGTTCAAAAAATACTTATGA
 Primer design