SecReT4
Protein ID: 330817366
T4SS name [ID]Trb [287]
Gene symbol-
Locus tagbgla_1g24910
StrainBurkholderia gladioli BSR3
Repliconchromosome 1 [GenBank: NC_015381] [Browse all T4SS(s) in this replicon]
Location [Strand]2871875..2873191 [-]
Productconjugation TrbI family protein
Component typeTrbI
UniProt IDF2LFE9
KEGG IDbgd:bgla_1g24910
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.2e-58, Aligned region: 242..424
Protein Sequence: 438 a.a.     [Download]
>gi|330817366|ref|YP_004361071.1| conjugation TrbI family protein [Burkholderia gladioli BSR3]
MSQDETPDVPIPDAAPKVAPENVTLRAQPRPVTRLNRRTLALLAGGLGVAVLGATMWSLQPKHSRSGNDA
TELYNVDRVSKSEELGQLPADYSKLPPQPTPLPAKVPELGPPLPGDLGPAIVNAQQPAVANYAPPGQDAA
ATERDALRKEAEAAAGSSVFFRSSNPQRAAAATAAPTQTASVAPESGLAGFDPQAAGPASTAAQPADPTA
VQNRQDQKEAFQKAGTTQTRNSGSLQTPASPYQVMAGTVIPAALVTGIKSDLPGDVIGTVTAPVYDTATG
RYLLIPQGSRILGKYNSQVAYGQSRVQIVWNRIILPDTSSLTLDNLAGADPAGYAGLEDGVDWHWGRILA
GAALSTILGVGSELAVSNQGNVNGNTVIAFRDSAQDTANQVGQEFTRRNLNIQPTLTERPGLPVSIIVNR
DIVLRPYQPLFFNRGTSP
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|330814956|ref|NC_015381.1|:c2873191-2871875 Burkholderia gladioli BSR3 chromosome 1, complete sequence
ATGAGCCAGGACGAAACCCCGGACGTGCCGATTCCCGATGCTGCGCCGAAGGTCGCGCCGGAGAACGTGA
CGCTGCGGGCGCAGCCGCGCCCGGTGACGCGCCTGAACCGGCGCACACTGGCGTTGCTGGCTGGCGGCCT
TGGCGTCGCCGTGCTGGGCGCAACGATGTGGTCGTTGCAGCCGAAGCACTCGCGCAGCGGCAACGATGCG
ACCGAGCTTTACAACGTGGATCGCGTGTCGAAATCCGAAGAACTCGGCCAGCTTCCCGCCGACTACTCGA
AGTTGCCGCCGCAGCCTACGCCGTTGCCGGCAAAGGTGCCGGAACTCGGGCCGCCGTTGCCGGGCGACCT
CGGCCCGGCCATCGTCAACGCGCAGCAGCCAGCGGTCGCCAATTACGCGCCGCCTGGTCAGGATGCGGCG
GCGACCGAGCGCGATGCGCTGCGCAAGGAGGCCGAAGCTGCGGCGGGTTCGTCGGTGTTCTTCCGTTCCA
GCAATCCGCAGCGTGCCGCTGCCGCGACCGCTGCGCCTACGCAGACCGCTTCGGTCGCGCCCGAATCTGG
CCTGGCCGGTTTCGACCCGCAGGCTGCCGGGCCAGCCTCGACGGCGGCGCAGCCGGCCGACCCGACCGCT
GTGCAGAACCGGCAAGACCAGAAAGAGGCATTCCAGAAAGCTGGAACGACGCAAACCCGTAATTCCGGCA
GTCTGCAAACGCCGGCCTCGCCGTATCAGGTAATGGCCGGCACGGTGATCCCGGCGGCACTGGTGACGGG
CATCAAGTCCGACCTGCCGGGCGACGTGATCGGCACCGTGACGGCGCCGGTGTACGACACGGCGACGGGG
CGCTATCTGCTGATTCCGCAGGGTTCACGCATCCTCGGCAAATACAACAGCCAGGTCGCCTACGGGCAGA
GCCGCGTGCAGATCGTGTGGAATCGCATCATCCTGCCGGACACGTCTTCGCTCACGCTCGACAACCTAGC
GGGTGCCGATCCGGCTGGCTATGCCGGTCTGGAGGACGGCGTCGATTGGCATTGGGGACGCATTCTGGCG
GGTGCCGCGCTGTCCACCATATTGGGCGTCGGTTCCGAGCTGGCTGTCTCGAACCAGGGCAATGTCAACG
GCAATACCGTCATCGCGTTCCGGGATAGCGCGCAGGACACGGCCAATCAGGTCGGCCAGGAATTTACGCG
CCGCAACCTCAACATCCAGCCGACCTTGACCGAACGGCCGGGCCTGCCCGTCAGCATCATCGTCAACCGC
GACATCGTGCTGCGGCCGTACCAGCCGCTGTTCTTCAATCGGGGGACTTCACCATGA
 Primer design